-
HPA036389-100ULImmunogen WD repeat domain 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by
-
HPA044147-100ULImmunogen WD repeat domain 35 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by
-
HPA042994-100ULThe gene WDR5B (WD repeat domain 5B) is mapped to human chromosome 3q21.1.
-
HPA042074-100UL
Sigma-Aldrich
Anti-WDR7 antibody produced in rabbit (C15-1457-049)
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA051057-100UL
Sigma-Aldrich
Anti-WDR7 antibody produced in rabbit (C15-1460-511)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to WD repeat domain 7 Sequence PASDSFRSDVGKAVENLIPPVQHILLDRKDKELLICPPVTRFFYGCREYFHKLLIQGDSSGRLNIWNISDTADKQGSEEGLAMTTSISLQEAFDKLNP Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA048212-100UL
Sigma-Aldrich
Anti-WDR72 antibody produced in rabbit (C15-1459-495)
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 72 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA057410-100UL
Sigma-Aldrich
Anti-WDR72 antibody produced in rabbit (C15-1462-653)
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 72 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA059819-100UL
Sigma-Aldrich
Anti-WDR72 antibody produced in rabbit (C15-1463-380)
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 72 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA039357-100ULWD repeat domain 73 (WDR73) belongs to WD repeat domain family of proteins. The motif contains 40-60 amino acids with tryptophan (W) and aspartate (D).
-
HPA037795-100UL
Sigma-Aldrich
Anti-WDR74 antibody produced in rabbit (C15-1454-909)
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 74 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA038419-100UL
Sigma-Aldrich
Anti-WDR74 antibody produced in rabbit (C15-1455-239)
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 74 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA038199-100ULImmunogen WD repeat domain 75 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by