Ustekinumab

Motor neuron and pancreas homeobox protein 1 (MNX1) is a transcription factor that is predominantly expressed in lymphoid and pancreatic tissues. It is involved in the development and function of the pancreas.

Immunogen methionine sulfoxide reductase B1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen methionine sulfoxide reductase B1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Melatonin receptor type 1B (UniProt: P49286 also known as Mel-1B-R Mel1b receptor) is encoded by the gene MTNR1B gene (Gene ID 4544) in human. Mel-1B-R is a high affinity receptor for melatonin that belongs to the G-protein coupled receptor 1

Melatonin receptor type 1B (UniProt: P49286 also known as Mel-1B-R, Mel1b receptor) is encoded by the MTNR1B gene (Gene ID: 4544) in human. Mel-1B-R is a member of the G-protein coupled 1 family that is predominantly expressed in retina and to

Melatonin receptor type 1B (UniProt: P49286 also known as Mel-1B-R, Mel1b receptor) is encoded by the MTNR1B gene (Gene ID: 4544) in human. Mel-1B-R is a member of the G-protein coupled 1 family that is predominantly expressed in retina and to

Immunogen melatonin receptor 1B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Purified mouse monoclonal antibody. Recognizes the ~40-45 kDa NDRG1 protein.

Immunogen Recombinant protein corresponding to nei like DNA glycosylase 2 Sequence DPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Immunogen Recombinant protein corresponding to nei like DNA glycosylase 2 Sequence IHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS Application All Prestige Antibodies Powered by Atlas Antibodies are

Neuropilin and tolloid-like protein 1, also known as Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 1, and encoded by the gene name NETO1 or BTCL1, is involved in the development and/or maintenance

Specificity Neurofascin, common epitope. By Western blot the antibody recognizes a band at ~186 kDa in mouse brain lysate.