-
Add to Cart The item has been added88022410-1VLAFRC IAH-CC15 ANTI BOVINE WC1 (C15-1311-235)
Price: $1,630.29List Price: $1,811.43Cell Line Origin Mouse NS1 x Mouse BALB/c spleen Cell Line Description The antibody is directed against WC1 antigen found on bovine CD4- CD8- and CD2- T cells which express gamma/delta TcR. The antigen has a molecular weight of 215-300kDa and is -
Add to Cart The item has been addedAV35409-100ULAnti-CHRFAM7A antibody produced in rabbit
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human CHRFAM7A Biochem/physiol Actions The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal -
Add to Cart The item has been addedHPA010510-100ULAnti-CNMD antibody produced in rabbit
Price: $879.43List Price: $977.14LECT1 (leukocyte cell derived chemotaxin 1) commonly known as chondromodulin-I (CHM-1), is a glycoprotein which is specific to cartilage. This gene is localized to human chromosome 13q14-21. -
Add to Cart The item has been addedHPA000427-100ULAnti-CSTF2 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Cleavage stimulation factor 64 kDa subunit recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA030900-100ULAnti-NCAM2 antibody produced in rabbit (C15-1452-885)
Price: $879.43List Price: $977.14Immunogen neural cell adhesion molecule 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA030901-100ULAnti-NCAM2 antibody produced in rabbit (C15-1452-886)
Price: $879.43List Price: $977.14Immunogen neural cell adhesion molecule 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA002327-100ULAnti-NCF2 antibody produced in rabbit (C15-1445-571)
Price: $879.43List Price: $977.14Neutrophil cytosolic factor 2 (NCF2) encodes for a core component of the multi-protein NADPH oxidase (NADPHO) that produces superoxide. Immunogen Neutrophil cytosol factor 2 recombinant protein epitope signature tag (PrEST) Application All Prestige -
Add to Cart The item has been addedHPA006040-100ULAnti-NCF2 antibody produced in rabbit (C15-1446-549)
Price: $879.43List Price: $977.14Immunogen Neutrophil cytosol factor 2 recombinant protein epitope signature tag (PrEST) Sequence MLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGRLFRPNERQVAQLAKKDYLGKATVVASVVDQDSFSGFAPLQPQAA -
Add to Cart The item has been addedHPA002640-100ULAnti-RAF1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Raf-1 proto-oncogene, serine/threonine kinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAPrEST73049-100PrEST Antigen CNNM3 cyclin and CBS domain divalent metal cat
Price: $537.65List Price: $597.39PrEST Antigen CNNM3 cyclin and CBS domain divalent metal cat -
Add to Cart The item has been addedAPrEST73140-100PrEST Antigen CNNM4 cyclin and CBS domain divalent metal cat
Price: $537.65List Price: $597.39PrEST Antigen CNNM4 cyclin and CBS domain divalent metal cat
