Zotarolimus

Immunogen zinc finger protein 642 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen ZFP69 zinc finger protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to ZFP82 zinc finger protein Sequence NHGLKGLILKNDWESTGKIEGQERPQEGYFSSVKMPSEKVSSYQKRTSVTPHQRLH Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen ZFP82 zinc finger protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen zinc finger protein 90 homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Ciliary neurotrophic factor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen ZFP91 zinc finger protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen zinc finger protein 92 homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

ZFPL1 (zinc finger protein-like 1) is a membrane protein, and forms a structural part of the Golgi apparatus. This gene is localized to human chromosome 11q13, and encodes a protein with predicted 310 amino acids.

ZFPL1 (zinc finger protein-like 1) is a type II integral ring finger phosphoprotein consisting of two predicted zinc fingers at its N-terminus and and a region near the C-terminus. It has a molecular weight of 34kDa.

Immunogen zinc finger protein, multitype 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Zinc finger RNA-binding protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are