-
Add to Cart The item has been addedHPA030194-100ULAnti-ZIC4 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Zic family member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA059975-100ULAnti-ZIK1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein interacting with K protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA071856-100ULAnti-ZIM2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger, imprinted 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA034575-100ULAnti-ZIM3 antibody produced in rabbit
Price: $889.20List Price: $988.00Immunogen zinc finger, imprinted 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA003201-100ULAnti-ZKSCAN5 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen zinc finger with KRAB and SCAN domains 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA012827-100ULAnti-ZMAT1 antibody produced in rabbit
Price: $879.43List Price: $977.14The gene ZMAT1 encoding zinc finger matrin-type protein-1 is mapped to human chromosome X. Immunogen Zinc finger matrin-type protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies -
Add to Cart The item has been addedHPA036518-100ULAnti-ZMAT2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger, matrin type 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedAV50793-100ULAnti-ZMAT3 antibody produced in rabbit (C15-1341-804)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human ZMAT3 Application Anti-ZMAT3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml. -
Add to Cart The item has been addedHPA028671-100ULAnti-ZMAT3 antibody produced in rabbit (C15-1451-950)
Price: $879.43List Price: $977.14Immunogen zinc finger, matrin-type 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA054356-100ULAnti-ZMAT3 antibody produced in rabbit (C15-1461-652)
Price: $928.29List Price: $1,031.43Immunogen zinc finger, matrin-type 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA056671-100ULAnti-ZMAT4 antibody produced in rabbit (C15-1462-417)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger matrin-type 4 Sequence MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADMVDKNKCCTLCN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedHPA069813-100ULAnti-ZMAT4 antibody produced in rabbit (C15-1465-759)
Price: $928.29List Price: $1,031.43Immunogen zinc finger, matrin-type 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
