-
HPA004858-100UL
Anti-ZMAT5 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Zinc finger matrin-type protein 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA045144-100UL
Anti-ZMIZ1 antibody produced in rabbit (C15-1458-424)
Price: $928.29List Price: $1,031.43Immunogen zinc finger, MIZ-type containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA071156-100UL
ANTI-ZMIZ1 ANTIBODY PRODUCED IN RABBIT (C15-1465-985)
Price: $977.14List Price: $1,085.71Immunogen zinc finger MIZ-type containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA040716-100UL
Anti-ZMIZ2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger, MIZ-type containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA006988-100UL
Anti-ZMPSTE24 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen CAAX prenyl protease 1 homolog recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA064019-100UL
Anti-ZMYM1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger, MYM-type 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA031765-100UL
Anti-ZMYM2 antibody produced in rabbit
Price: $889.20List Price: $988.00Immunogen zinc finger, MYM-type 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA003211-100UL
Anti-ZMYM3 antibody produced in rabbit (C15-1445-844)
Price: $879.43List Price: $977.14Immunogen Zinc finger MYM-type protein 3 recombinant protein epitope signature tag (PrEST) Application Anti-ZMYM3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody -
HPA075255-100UL
Anti-ZMYM3 antibody produced in rabbit (C15-1466-704)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger MYM-type containing 3 Sequence MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGPSPSSGALDLLDTPAGLEKDPGVLDGATE Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
HPA051301-100UL
Anti-ZMYM4 antibody produced in rabbit (C15-1460-612)
Price: $928.29List Price: $1,031.43Immunogen zinc finger, MYM-type 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA054802-100UL
Anti-ZMYM4 antibody produced in rabbit (C15-1461-795)
Price: $928.29List Price: $1,031.43Immunogen zinc finger, MYM-type 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA015544-100UL
ANTI-ZMYM5 ANTIBODY PRODUCED IN RABBIT (C15-1448-363)
Price: $977.14List Price: $1,085.71Immunogen zinc finger MYM-type containing 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization