-
Add to Cart The item has been addedHPA023137-100ULSigma-Aldrich
Anti-ZBTB2 antibody produced in rabbit (C15-1450-268)
Price: $879.43List Price: $977.14The gene ZBTB2 (zinc finger and BTB domain containing 2) is mapped to human chromosome 6q25. It belongs to the POK (POZ and Krüppel) family of proteins. -
Add to Cart The item has been addedHPA023458-100ULSigma-Aldrich
Anti-ZBTB2 antibody produced in rabbit (C15-1450-413)
Price: $879.43List Price: $977.14The gene ZBTB2 (zinc finger and BTB domain containing 2) is mapped to human chromosome 6q25.1. -
Add to Cart The item has been addedHPA023487-100ULSigma-Aldrich
Anti-ZBTB2 antibody produced in rabbit (C15-1450-417)
Price: $879.43List Price: $977.14The gene ZBTB2 (zinc finger and BTB domain containing 2) is mapped to human chromosome 6q25.1. -
Add to Cart The item has been addedHPA016815-100ULImmunogen Zinc finger and BTB domain-containing protein 20 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedHPA064763-100ULImmunogen zinc finger and BTB domain containing 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA000703-100ULSigma-Aldrich
Anti-ZBTB42 antibody produced in rabbit (C15-1445-031)
Price: $879.43List Price: $977.14Immunogen zinc finger and BTB domain containing 42 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA066961-100ULSigma-Aldrich
Anti-ZBTB42 antibody produced in rabbit (C15-1465-190)
Price: $928.29List Price: $1,031.43Immunogen zinc finger and BTB domain containing 42 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAV50690-100ULSigma-Aldrich
Anti-ZBTB46 antibody produced in rabbit (C15-1341-801)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human ZBTB46 Biochem/physiol Actions ZBTB46 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers. ZBTB46 may be involved in transcriptional regulation. -
Add to Cart The item has been addedHPA013997-100ULSigma-Aldrich
Anti-ZBTB46 antibody produced in rabbit (C15-1448-051)
Price: $879.43List Price: $977.14The gene ZBTB46 (zinc finger and BTB domain containing 46) encodes a zinc finger transcription factor that is expressed specifically by classical dendritic cells (cDCs) and committed cDC precursors. It is not expressed by monocytes, pDCs -
Add to Cart The item has been addedHPA030417-100ULImmunogen zinc finger and BTB domain containing 48 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA021521-100ULImmunogen zinc finger and BTB domain containing 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA065062-100ULImmunogen Recombinant protein corresponding to zinc finger C2HC-type containing 1C Sequence SRNFGVRNQGNFSVVGTVLAATQAEKAVANFDRTEWVQIRRLEAAGESLEEEIRRKQILLRGKLKKTEEELRRIQTQK Application All Prestige Antibodies Powered by Atlas Antibodies are developed
