-
Add to Cart The item has been addedAV50803-100ULAnti-ZNF385B antibody produced in rabbit (C15-1341-805)
Price: $898.29List Price: $998.10The gene ZNF385B (Zinc finger protein 385B) is mapped to human chromosome 2q31.2-q31. -
Add to Cart The item has been addedHPA046086-100ULAnti-ZNF385B antibody produced in rabbit (C15-1458-723)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 385B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA036190-100ULAnti-ZNF385D antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 385D recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedAV51115-100ULAnti-ZNF389 antibody produced in rabbit
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human ZNF389 Application Anti-ZNF389 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml. -
Add to Cart The item has been addedHPA050886-100ULAnti-ZNF391 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 391 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA051421-100ULAnti-ZNF394 antibody produced in rabbit (C15-1460-657)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 394 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA054639-100ULAnti-ZNF394 antibody produced in rabbit (C15-1461-744)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 394 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA076275-100ULANTI-ZNF395 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen zinc finger protein 395 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA006686-100ULAnti-ZNF396 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Zinc finger protein 396 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedAV39691-100ULAnti-ZNF397 antibody produced in rabbit (C15-1341-177)
Price: $759.43List Price: $843.81ZNF397 is a centromeric zinc finger protein that has a SCAN domain and functions as a transcriptional regulator. It has been classified as an interphase to early prophase-specific protein in mammals. -
Add to Cart The item has been addedHPA026087-100ULAnti-ZNF397 antibody produced in rabbit (C15-1451-015)
Price: $879.43List Price: $977.14Zinc finger protein 397 (ZNF397) belongs to the Cys2His2 group of the zinc-finger superfamily. It possesses a leucine-rich SCAN domain and nine Cys2His2 zinc fingers. -
Add to Cart The item has been addedHPA063607-100ULAnti-ZNF404 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger protein 404 Sequence VSLDFNFTTESNKLSSEKRNYEVNAYHQETWKRNKTFNLMRFIFRTDPQYTI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein
