-
HPA055430-100UL
Anti-ZNF555 antibody produced in rabbit (C15-1462-013)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 555 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA060593-100UL
Anti-ZNF556 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 556 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA029291-100UL
Anti-ZNF557 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen zinc finger protein 557 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA003151-100UL
Anti-ZNF558 antibody produced in rabbit
Price: $879.43List Price: $977.14The zinc finger proteins (ZNFs) are made up of anti-parallel hairpin motif. These proteins contain an α-helix, two β-strands and a hairpin structure. -
HPA059632-100UL
Anti-ZNF559 antibody produced in rabbit (C15-1463-336)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 559 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA065485-100UL
Anti-ZNF559 antibody produced in rabbit (C15-1464-896)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 559 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA045439-100UL
Anti-ZNF560 antibody produced in rabbit (C15-1458-513)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger protein 560 Sequence KDLLSLYNKTSTIRKVSVFSKHGKSFRLILNVQVQRKCTQDKSFEGTDYGKAFIYQSYLEAHR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
HPA063209-100UL
Anti-ZNF560 antibody produced in rabbit (C15-1464-307)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger protein 560 Sequence ISWLEEEELRTLQQGVLQDWAIKHQTSVSALQQEFWKIQTSNGIQMDLVTFDS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
HPA074438-100UL
ANTI-ZNF560 ANTIBODY PRODUCED IN RABBIT (C15-1466-557)
Price: $977.14List Price: $1,085.71Immunogen zinc finger protein 560 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA055332-100UL
Anti-ZNF561 antibody produced in rabbit (C15-1461-981)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 561 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA062397-100UL
Anti-ZNF561 antibody produced in rabbit (C15-1464-065)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 561 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA042136-100UL
Anti-ZNF563 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 563 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported