-
HPA060782-100UL
Anti-ZNF586 antibody produced in rabbit (C15-1463-623)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 586 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA043288-100UL
Anti-ZNF587 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 587 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA003145-100UL
Anti-ZNF589 antibody produced in rabbit
Price: $879.43List Price: $977.14The zinc finger proteins (ZNFs) are made up of anti-parallel hairpin motif. These proteins contain an α-helix, two β-strands and a hairpin structure. -
HPA020332-100UL
Anti-ZNF592 antibody produced in rabbit (C15-1449-569)
Price: $879.43List Price: $977.14Zinc finger protein 592 (ZNF592) is a 1267 amino acid protein which contains C2H2-type domains. The gene encoding it is localized on human chromosome 15q24-q26. -
HPA021600-100UL
Anti-ZNF592 antibody produced in rabbit (C15-1449-936)
Price: $879.43List Price: $977.14Immunogen Zinc finger protein 592 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA054363-100UL
Anti-ZNF593 antibody produced in rabbit (C15-1461-654)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 593 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA059387-100UL
Anti-ZNF593 antibody produced in rabbit (C15-1463-243)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 593 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA060283-100UL
Anti-ZNF594 antibody produced in rabbit (C15-1463-493)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger protein 594 Sequence IREMHIIPQKAIVGEIGHGCNEGEKILSAGESSHRYEVSGQNFKQKSGLTEHQK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
HPA067178-100UL
Anti-ZNF594 antibody produced in rabbit (C15-1465-242)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 594 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA069360-100UL
Anti-ZNF594 antibody produced in rabbit (C15-1465-665)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger protein 594 Sequence LHAGEKLEECEKTFSKDEELRKEQRTHQEKKVYWCNQCSRTFQGSSDLIRH Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
HPA074493-100UL
ANTI-ZNF594 ANTIBODY PRODUCED IN RABBIT (C15-1466-568)
Price: $977.14List Price: $1,085.71Immunogen zinc finger protein 594 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA077596-100UL
ANTI-ZNF594 ANTIBODY PRODUCED IN RABBIT (C15-1467-057)
Price: $977.14List Price: $1,085.71Immunogen zinc finger protein 594 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the