Skip to main content

Zotarolimus

Compare
  
  • anti-znf620 antibody produced in rabbit (c15-1463-241)
    Add to Cart The item has been added
    HPA059383-100UL

    Anti-ZNF620 antibody produced in rabbit (C15-1463-241)

    Price: $928.29
    List Price: $1,031.43
    Immunogen Recombinant protein corresponding to zinc finger protein 620 Sequence EKEGLTPKDHVSKETESFRLMVGGLPGNVSQHLDFGSSLEQPQGHWIIKTK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein
    Hide Expand
    SKUHPA059383-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1463-241
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1463-241
    Description
    Immunogen Recombinant protein corresponding to zinc finger protein 620 Sequence EKEGLTPKDHVSKETESFRLMVGGLPGNVSQHLDFGSSLEQPQGHWIIKTK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein
  • anti-znf621 antibody produced in rabbit (c15-1464-901)
    Add to Cart The item has been added
    HPA065518-100UL

    Anti-ZNF621 antibody produced in rabbit (C15-1464-901)

    Price: $928.29
    List Price: $1,031.43
    Immunogen zinc finger protein 621 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
    Hide Expand
    SKUHPA065518-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1464-901
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1464-901
    Description
    Immunogen zinc finger protein 621 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
  • anti-znf621 antibody produced in rabbit (c15-1466-041)
    Add to Cart The item has been added
    HPA071440-100UL

    Anti-ZNF621 antibody produced in rabbit (C15-1466-041)

    Price: $928.29
    List Price: $1,031.43
    Immunogen zinc finger protein 621 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
    Hide Expand
    SKUHPA071440-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1466-041
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1466-041
    Description
    Immunogen zinc finger protein 621 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
  • anti-znf622 antibody produced in rabbit (c15-1454-398)
    Add to Cart The item has been added
    HPA036514-100UL

    Anti-ZNF622 antibody produced in rabbit (C15-1454-398)

    Price: $928.29
    List Price: $1,031.43
    Immunogen zinc finger protein 622 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
    Hide Expand
    SKUHPA036514-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1454-398
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1454-398
    Description
    Immunogen zinc finger protein 622 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
  • anti-znf622 antibody produced in rabbit (c15-1454-399)
    Add to Cart The item has been added
    HPA036515-100UL

    Anti-ZNF622 antibody produced in rabbit (C15-1454-399)

    Price: $928.29
    List Price: $1,031.43
    Immunogen zinc finger protein 622 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
    Hide Expand
    SKUHPA036515-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1454-399
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1454-399
    Description
    Immunogen zinc finger protein 622 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
  • anti-znf623 antibody produced in rabbit
    Add to Cart The item has been added
    HPA044372-100UL

    Anti-ZNF623 antibody produced in rabbit

    Price: $928.29
    List Price: $1,031.43
    Immunogen zinc finger protein 623 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
    Hide Expand
    SKUHPA044372-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1458-123
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1458-123
    Description
    Immunogen zinc finger protein 623 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
  • anti-znf624 antibody produced in rabbit (c15-1450-282)
    Add to Cart The item has been added
    HPA023157-100UL

    Anti-ZNF624 antibody produced in rabbit (C15-1450-282)

    Price: $879.43
    List Price: $977.14
    Immunogen zinc finger protein 624 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
    Hide Expand
    SKUHPA023157-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1450-282
    Pack Size 100 UL
    Price:
    Price: $879.43
    List Price: $977.14
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1450-282
    Description
    Immunogen zinc finger protein 624 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
  • anti-znf624 antibody produced in rabbit (c15-1450-307)
    Add to Cart The item has been added
    HPA023244-100UL

    Anti-ZNF624 antibody produced in rabbit (C15-1450-307)

    Price: $879.43
    List Price: $977.14
    Immunogen zinc finger protein 624 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
    Hide Expand
    SKUHPA023244-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1450-307
    Pack Size 100 UL
    Price:
    Price: $879.43
    List Price: $977.14
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1450-307
    Description
    Immunogen zinc finger protein 624 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
  • anti-znf625 antibody produced in rabbit
    Add to Cart The item has been added
    HPA074014-100UL

    Anti-ZNF625 antibody produced in rabbit

    Price: $928.29
    List Price: $1,031.43
    Immunogen zinc finger protein 625 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
    Hide Expand
    SKUHPA074014-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1466-486
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1466-486
    Description
    Immunogen zinc finger protein 625 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
  • anti-znf626 antibody produced in rabbit
    Add to Cart The item has been added
    HPA045631-100UL

    Anti-ZNF626 antibody produced in rabbit

    Price: $928.29
    List Price: $1,031.43
    Immunogen zinc finger protein 626 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
    Hide Expand
    SKUHPA045631-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1458-589
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1458-589
    Description
    Immunogen zinc finger protein 626 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
  • anti-znf627 antibody produced in rabbit (c15-1460-054)
    Add to Cart The item has been added
    HPA049770-100UL

    Anti-ZNF627 antibody produced in rabbit (C15-1460-054)

    Price: $928.29
    List Price: $1,031.43
    Immunogen zinc finger protein 627 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
    Hide Expand
    SKUHPA049770-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1460-054
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1460-054
    Description
    Immunogen zinc finger protein 627 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
  • anti-znf627 antibody produced in rabbit (c15-1466-373)
    Add to Cart The item has been added
    HPA073463-100UL

    Anti-ZNF627 antibody produced in rabbit (C15-1466-373)

    Price: $928.29
    List Price: $1,031.43
    Immunogen zinc finger protein 627 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
    Hide Expand
    SKUHPA073463-100UL
    MFR. NameSigma-Aldrich
    Catalog No. C15-1466-373
    Pack Size 100 UL
    Price:
    Price: $928.29
    List Price: $1,031.43
    Quantity:
     
    Add to Cart The item has been added

    Product Information

    Catalog No.
    C15-1466-373
    Description
    Immunogen zinc finger protein 627 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Lab - Point of Care

Lab Equipment & Accessories

Chemicals, Stains and Reagents

Medical Equipment

!