-
HPA066468-100UL
Anti-ZNF646 antibody produced in rabbit (C15-1465-082)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger protein 646 Sequence YQCSLCPRKYPNLMALRNHVRVHCKAARRSADIGAEGAPSHLKVELPPDPVEAEAAPHTDQDHVCKHEEEATDITPAADKTAAHICSICGLLFEDAE Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA053897-100UL
Anti-ZNF648 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 648 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA026541-100UL
Anti-ZNF649 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Zinc finger protein 649 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA044408-100UL
Anti-ZNF652 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 652 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA023631-100UL
Anti-ZNF653 antibody produced in rabbit (C15-1450-466)
Price: $879.43List Price: $977.14Immunogen zinc finger protein 653 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA023635-100UL
Anti-ZNF653 antibody produced in rabbit (C15-1450-470)
Price: $879.43List Price: $977.14Immunogen zinc finger protein 653 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA036172-100UL
Anti-ZNF654 antibody produced in rabbit (C15-1454-215)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 654 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA036173-100UL
Anti-ZNF654 antibody produced in rabbit (C15-1454-216)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 654 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA077939-100UL
Anti-ZNF654 antibody produced in rabbit (C15-1467-116)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger protein 654 Sequence CQRQFEDSQHFIDHLNRHSYPNVYFCLHFNCNESFKLPFQLAQHTKSHRTFQAQCSFPECHELFEDLPLLYEHEA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
HPA029534-100UL
Anti-ZNF655 antibody produced in rabbit (C15-1452-310)
Price: $879.43List Price: $977.14Immunogen zinc finger protein 655 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA050750-100UL
Anti-ZNF655 antibody produced in rabbit (C15-1460-400)
Price: $967.37List Price: $1,074.86Immunogen zinc finger protein 655 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA047730-100UL
Anti-ZNF658 antibody produced in rabbit (C15-1459-315)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 658 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported