-
Add to Cart The item has been addedHPA023930-100ULAnti-ZNF703 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Zinc finger protein 703 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA024285-100ULAnti-ZNF704 antibody produced in rabbit (C15-1450-704)
Price: $879.43List Price: $977.14Immunogen Zinc finger protein 704 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA024302-100ULAnti-ZNF704 antibody produced in rabbit (C15-1450-715)
Price: $879.43List Price: $977.14Immunogen Zinc finger protein 704 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedAV32987-100ULAnti-ZNF706 antibody produced in rabbit
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human ZNF706 Sequence Synthetic peptide located within the following region: MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPD Physical form Purified antibody supplied in 1x PBS -
Add to Cart The item has been addedHPA044991-100ULAnti-ZNF707 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 707 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA045573-100ULAnti-ZNF709 antibody produced in rabbit (C15-1458-564)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 709 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA053153-100ULAnti-ZNF709 antibody produced in rabbit (C15-1461-250)
Price: $928.29List Price: $1,031.43Immunogen zinc finger protein 709 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA018124-100ULAnti-ZNF71 antibody produced in rabbit
Price: $879.43List Price: $977.14Zinc finger protein 71 (ZNF71) is induced by tumor necrosis factor α (TNFα). It is composed of 490 amino acids and possesses 13 C2H2 zinc finger motifs. -
Add to Cart The item has been addedHPA030226-100ULAnti-ZNF710 antibody produced in rabbit (C15-1452-605)
Price: $879.43List Price: $977.14Immunogen zinc finger protein 710 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA030227-100ULAnti-ZNF710 antibody produced in rabbit (C15-1452-606)
Price: $879.43List Price: $977.14Immunogen zinc finger protein 710 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA030228-100ULAnti-ZNF710 antibody produced in rabbit (C15-1452-607)
Price: $879.43List Price: $977.14Immunogen zinc finger protein 710 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA030654-100ULAnti-ZNF711 antibody produced in rabbit
Price: $879.43List Price: $977.14ZNF711 (zinc finger protein 711) gene is mapped to human chromosome Xq21.1 and encodes a zinc finger transcription factor.
