-
HPA076065-100UL
Anti-ZC3H6 antibody produced in rabbit (C15-1466-822)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to zinc finger CCCH-type containing 6 Sequence ISGSYITSKKGQHNKKFKSKEYDEYSTYSDDNFGNYSDDNFGNYGQETEEDFANQLKQYRQAKETSNIALGSSFSKESGKKQRMKGVQQGI Application All Prestige Antibodies Powered by Atlas Antibodies -
HPA040808-100UL
Anti-ZC3H7A antibody produced in rabbit (C15-1456-367)
Price: $928.29List Price: $1,031.43Immunogen zinc finger CCCH-type containing 7A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA059849-100UL
Anti-ZC3H7A antibody produced in rabbit (C15-1463-390)
Price: $928.29List Price: $1,031.43Immunogen zinc finger CCCH-type containing 7A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA001784-100UL
Anti-ZC3H7B antibody produced in rabbit (C15-1445-409)
Price: $879.43List Price: $977.14Zinc finger CCCH-type containing 7B (ZC3H7B) is 110kDa cellular protein, also termed as rotavirus X protein associated with NSP3 (RoXaN). It consists of mainly three regions which are involved in the protein-protein or nucleic acid-protein -
HPA076092-100UL
ANTI-ZC3H7B ANTIBODY PRODUCED IN RABBIT (C15-1466-827)
Price: $977.14List Price: $1,085.71Immunogen zinc finger CCCH-type containing 7B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA034803-100UL
Anti-ZC3H8 antibody produced in rabbit (C15-1453-565)
Price: $889.20List Price: $988.00Immunogen zinc finger CCCH-type containing 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA034804-100UL
Anti-ZC3H8 antibody produced in rabbit (C15-1453-566)
Price: $889.20List Price: $988.00Immunogen zinc finger CCCH-type containing 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA027412-100UL
Anti-ZCCHC11 antibody produced in rabbit (C15-1451-479)
Price: $879.43List Price: $977.14Immunogen Zinc finger CCHC domain-containing protein 11 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA027973-100UL
Anti-ZCCHC11 antibody produced in rabbit (C15-1451-671)
Price: $879.43List Price: $977.14Immunogen zinc finger, CCHC domain containing 11 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA051991-100UL
Anti-ZCCHC5 antibody produced in rabbit (C15-1460-865)
Price: $928.29List Price: $1,031.43Immunogen zinc finger, CCHC domain containing 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA053174-100UL
Anti-ZCCHC5 antibody produced in rabbit (C15-1461-260)
Price: $928.29List Price: $1,031.43Immunogen zinc finger, CCHC domain containing 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA075136-100UL
Anti-ZCCHC5 antibody produced in rabbit (C15-1466-679)
Price: $928.29List Price: $1,031.43Immunogen zinc finger, CCHC domain containing 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive