Zotarolimus

The zinc finger proteins (ZNFs) are made up of anti-parallel hairpin motif. These proteins contain an &#945-helix, two &#946-strands and a hairpin structure.

Helios/IKAROS family zinc finger 2 (ANF1A2, ZNF1A2, ZNFN1A2), a member of the Ikaros family of zinc-finger transcription factors, is a hematopoietic-specific transcription factors involved in the regulation of early lymphocyte development. Helios

Immunogen zinc finger, NFX1-type containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

The gene ZNHIT1 (zinc finger HIT domain-containing gene) is mapped to human chromosome 7q22.1.

Immunogen Synthetic peptide directed towards the N terminal region of human ZNHIT3 Application Anti-ZNHIT3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0&#956g/ml.

Immunogen zinc finger, HIT-type containing 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen zinc finger HIT-type containing 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

The gene has been mapped to human chromosome 1p22.3.

Immunogen zinc ribbon domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Recombinant protein corresponding to zinc ribbon domain containing 1 Sequence GTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen zinc and ring finger 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Recombinant protein corresponding to zinc and ring finger 2 Sequence NSSSGPYGSQDSVHSSPEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and