Radiopharmaceuticals and contrast media

Huntington disease (HD) is a progressive neurodegenerative disorder is caused by a CAG,CTG expansion in the HTT gene that results in the production of a mutant huntingtin protein (HTT) with polymeric expansions that accumulate in human brain with

Immunogen Synthetic peptide directed towards the middle region of human RFPL3 Sequence Synthetic peptide located within the following region: DADTANNFLLISDDLRSVRSGLITQNRQDLAERFDVSVCILGSPRFTCGR Physical form Purified antibody supplied in 1x PBS

Immunogen SEC22 homolog C, vesicle trafficking protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene encoding protein transport protein Sec23 homolog B (SEC23B) is about 54kb long and located on the chromosome 20p11.23.

Immunogen SEC24 homolog A, COPII coat complex component Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen SEC24 family, member B (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen SEC24 family, member C ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to T-box 19 Sequence EVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

TCAP codes for a protein that binds to titin and acts as a substrate for titin kinase, thereby playing an important role in sarcomere assembly. Genetic mutations in Tcap have been linked to cardiomyopathies .

Immunogen Treacher Collins-Franceschetti syndrome 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Tudor domain-containing protein 3 (UniProt: Q9H7E2 also known as TDRD3) is encoded by the TDRD3 gene (Gene ID: 81550) in human. TDRD3 belongs to an evolutionarily conserved family of 12 proteins (TDRD1-TDRD12) that contain one or more Tudor

Transcription factor E3 (UniProt P19532 also known as bHLHe33, Class E basic helix-loop-helix protein 33, TFE3) is encoded by the TFE3 (also known as BHLHE33) gene (Gene ID 7030) in human. TFE3 contains adjacent helix-loop-helix (HLH) and leucine