Radiopharmaceuticals and contrast media

Immunogen TIMP metallopeptidase inhibitor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen transmembrane 9 superfamily member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Transmembrane protein 100 (UniProt: Q9CQG9 also known as TMEM100) is encoded by the Tmem100 gene (Gene ID: 67888) in murine species. TMEM100 is a multi-pass membrane protein that is shown to be involved in renal development, vasculogenesis and

Transmembrane protein 100 (UniProt: Q9CQG9 also known as TMEM100) is encoded by the Tmem100 gene (Gene ID: 67888) in murine species. TMEM100 is a multi-pass membrane protein that is shown to be involved in renal development, vasculogenesis and

Transmembrane protein 119 (TMEM119) is encoded by the gene mapped to human chromosome 12q23.3.

Immunogen transmembrane protein 119 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to transmembrane protein 236 Sequence LRGSQKSSENGHIHSTSLQHIKTVTEQVRQSPENAASPQATNSTQVSQPSGAMTRSQESVFMGPQEPSCDSGILRMMSRRDVRAELFLWSFLLWSD Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen transmembrane protein 92 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen troponin I type 3 (cardiac) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen tensin 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen tensin 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Synthetic peptide directed towards the middle region of human TSG101 Biochem/physiol Actions TSG101 has a direct role in the control of growth and differentiation in primary epithelial cells. It is required for normal cell function of