-
Add to Cart The item has been addedHPA040196-25ULANTI-SEC24C
Price: $540.00List Price: $600.00Immunogen SEC24 family, member C ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA072686-25ULANTI-TBX19
Price: $540.00List Price: $600.00Immunogen Recombinant protein corresponding to T-box 19 Sequence EVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been added52595-1MGAtto 514 (C15-1304-876)
Price: $431.63List Price: $479.59Atto 514 is a new hydrophilic fluorescent label with excellent water solubility. The dye exhibits strong absorption, high fluorescence quantum yield and exceptional thermal and photo-stability. -
Add to Cart The item has been added70425-1MG-FAtto 590 (C15-1307-910)
Price: $240.00List Price: $266.67Application Atto fluorescent labels are designed for high sensitivity applications, including single-molecule detection. Atto labels have rigid structures that do not show any cis-trans isomerization. -
Add to Cart The item has been added110754B302 3.5X5 BLK/RED/GRN/WHT 10/PK
Price: $68.75List Price: $76.39B-302 is an indoor/outdoor high performance pressure sensitive safety sign, and is surface printed polyester with a polyester overlaminate. Weathers up to 8 years outdoors, even longer indoors, and withstands wide temperature variations (up to -
Add to Cart The item has been added114523B302-3.5X5-OO-O-10/PK-3.5HX5W ORANGE
Price: $68.75List Price: $76.39B-302 is an indoor/outdoor high performance pressure sensitive safety sign, and is surface printed polyester with a polyester overlaminate. Weathers up to 8 years outdoors, even longer indoors, and withstands wide temperature variations (up to -
Add to Cart The item has been added110750B302-3.5X5-WG-O, BLK,BLU/WHT 10/PK
Price: $68.75List Price: $76.39B-302 is an indoor/outdoor high performance pressure sensitive safety sign, and is surface printed polyester with a polyester overlaminate. Weathers up to 8 years outdoors, even longer indoors, and withstands wide temperature variations (up to -
Add to Cart The item has been added110745B302-3.5X5-WG-O, BLK/RED/WHT 10/PK
Price: $68.75List Price: $76.39B-302 is an indoor/outdoor high performance pressure sensitive safety sign, and is surface printed polyester with a polyester overlaminate. Weathers up to 8 years outdoors, even longer indoors, and withstands wide temperature variations (up to -
Add to Cart The item has been added86261B302-3.5X5-WG-O-5/PK-BLK/BLU/WHT 5/PK O
Price: $47.99List Price: $53.33B-302 is an indoor/outdoor high performance pressure sensitive safety sign, and is surface printed polyester with a polyester overlaminate. Weathers up to 8 years outdoors, even longer indoors, and withstands wide temperature variations (up to -
Add to Cart The item has been addedB0186-1MGBI-6C9 (C15-1282-933)
Price: $200.14List Price: $222.38Biochem/physiol Actions BI-6C9 is a tBid inhibitor and antiapoptotic. -
Add to Cart The item has been addedB0186-5MGBI-6C9 (C15-1282-934)
Price: $555.43List Price: $617.14Biochem/physiol Actions BI-6C9 is a tBid inhibitor and antiapoptotic. -
