Technetium Tc-99m/99mtc teboroxime

Cell Line Origin Human placenta, SV40 transformed Cell Line Description Established by SV40 ts30 transformation of human placental cells. The cells express the transformed phenotype at the permissive temperature (33C) and the non-transformed

Immunogen Cathepsin S precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

TCAP codes for a protein that binds to titin and acts as a substrate for titin kinase, thereby playing an important role in sarcomere assembly. Genetic mutations in Tcap have been linked to cardiomyopathies .

Immunogen Treacher Collins-Franceschetti syndrome 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Tudor domain-containing protein 3 (UniProt: Q9H7E2 also known as TDRD3) is encoded by the TDRD3 gene (Gene ID: 81550) in human. TDRD3 belongs to an evolutionarily conserved family of 12 proteins (TDRD1-TDRD12) that contain one or more Tudor

Transmembrane protein 100 (UniProt: Q9CQG9 also known as TMEM100) is encoded by the Tmem100 gene (Gene ID: 67888) in murine species. TMEM100 is a multi-pass membrane protein that is shown to be involved in renal development, vasculogenesis and

Transmembrane protein 100 (UniProt: Q9CQG9 also known as TMEM100) is encoded by the Tmem100 gene (Gene ID: 67888) in murine species. TMEM100 is a multi-pass membrane protein that is shown to be involved in renal development, vasculogenesis and

Transmembrane protein 119 (TMEM119) is encoded by the gene mapped to human chromosome 12q23.3.

Immunogen transmembrane protein 119 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to transmembrane protein 236 Sequence LRGSQKSSENGHIHSTSLQHIKTVTEQVRQSPENAASPQATNSTQVSQPSGAMTRSQESVFMGPQEPSCDSGILRMMSRRDVRAELFLWSFLLWSD Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen transmembrane protein 92 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen troponin I type 3 (cardiac) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the