-
Add to Cart The item has been added319899-25GAnthrone (C15-1291-700)
Price: $187.29List Price: $208.10Anthrone, also known as 9(10H)-Anthracenone, is a planar tricyclic aromatic ketone. In acidic conditions, anthrone reacts with carbohydrate to yield a blue-green color. -
Add to Cart The item has been added52445-100MGAnthrone (C15-1291-701)
Price: $169.95List Price: $188.83Application Refer to the product′s Certificate of Analysis for more information on a suitable instrument technique. Contact Technical Service for further support. -
Add to Cart The item has been added8014610010ANTHRONE FOR SYNTHESIS 10 G
Price: $165.81List Price: $184.23Analysis Note Assay (LC-MS): ≥ 97.0 % (a/a) Identity (IR): passes test -
Add to Cart The item has been added8014610100ANTHRONE FOR SYNTHESIS 100 G
Price: $578.67List Price: $642.97Analysis Note Assay (LC-MS): ≥ 97.0 % (a/a) Identity (IR): passes test -
Add to Cart The item has been added8014610025ANTHRONE FOR SYNTHESIS 25 G
Price: $216.17List Price: $240.19Analysis Note Assay (LC-MS): ≥ 97.0 % (a/a) Identity (IR): passes test -
Add to Cart The item has been addedHPA044578-100ULAnti-ADH5 antibody produced in rabbit (C15-1458-202)
Price: $928.29List Price: $1,031.43Immunogen alcohol dehydrogenase 5 (class III), chi polypeptide recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA061919-100ULAnti-ADH5 antibody produced in rabbit (C15-1463-942)
Price: $928.29List Price: $1,031.43Immunogen alcohol dehydrogenase 5 (class III), chi polypeptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA067946-100ULAnti-ADH6 (C15-1465-405)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to alcohol dehydrogenase 6 (class V) Sequence AKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHEG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA069081-100ULAnti-ADH6 (C15-1465-603)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to alcohol dehydrogenase 6 (class V) Sequence VADYMAEKLNLDPLITHTLNLDKINEAVELMKTGKW Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA036961-100ULAnti-ADPRH antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ADP-ribosylarginine hydrolase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA023265-100ULAnti-ADPRM antibody produced in rabbit (C15-1450-321)
Price: $879.43List Price: $977.14The gene ADPRM (ADP-ribose/CDP-alcohol diphosphatase, manganese dependent) is mapped to human chromosome 17p13. It is a member of the metallo-dependent phosphatases (MDP) superfamily. -
Add to Cart The item has been addedHPA023820-100ULAnti-ADPRM antibody produced in rabbit (C15-1450-515)
Price: $879.43List Price: $977.14Immunogen Magnesium-dependent ADP-ribose/CDP-alcohol diphosphatase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)
