Sympathomimetic or adrenergic drugs

Immunogen protein tyrosine phosphatase, receptor type, D Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen quinolinate phosphoribosyltransferase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen quinolinate phosphoribosyltransferase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene QRFPR (pyroglutamylated RFamide peptide receptor) is also referred to as GPR103. It encodes an orphan G protein-coupled receptor that is mainly expressed in the cerebral cortex, pituitary, thalamus, hypothalamus, basal forebrain, midbrain,

Immunogen pyroglutamylated RFamide peptide receptor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Synaptonemal complex protein 2 (UniProt: Q9CUU3 also known as SCP-2, SYCP2, Synaptonemal complex lateral element protein) is encoded by the Sycp2 (also known as Scp2) gene (Gene ID: 320558) in murine species.SYCP2 is present in testis and

Immunogen Recombinant protein corresponding to synaptotagmin 5 Sequence CRRRTGKKSQAQAQVHLQEVKGLGQSYIDKVQPEVEELEPAPS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

TAF10 is a transcription factor that forms a part of the TFIID and other regulatory complexes (such as SAGA, TFTC, STAGA and PCAF/GCN5). TAF10 is required for mouse embryogenesis and is known to establish skin barrier function in fetal mouse

Specificity Taurine. The antibody has been calibrated against a spectrum of antigens to assure hapten selectivity and proper affinity.

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the

Application Aprindine hydrochloride is a class Ib antiarrhythmic and hERG channel blocker. Aprindine hydrochloride also inhibits the activities of calmodulin-sitmulated cyclic 3&#8242:5&#8242-nucleotide phosphodiesterase and Ca-ATPase.