Adrenalone

OR Grade Premium surgical Instruments, Germany Stainless

OR Grade Premium surgical Instruments, Germany Stainless

OR Grade Premium surgical Instruments, Germany Stainless

OR Grade Premium surgical Instruments, Germany Stainless

OR Grade Premium surgical Instruments, Germany Stainless

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including MSDS and any product information leaflets have been developed and issued under the Authority of the

Advantame &#174 is a high intensity, non-caloric sweetener, which is derived from aspartame. It is widely used in food and beverage industry.

Application ADVASEP &#8482 -7 has been used in washing solution to remove excess dyes, FM4-64FX and FM1-43, in stained cells. Biochem/physiol Actions ADVASEP &#8482 -7 is a &#946-cyclodextran derivative.

ADVASEP-7 is a sulfonated &beta-cyclodextrin derivative that has been reported to reduce background fluorescence when using SynaptoGreen C4 to stain brain slices.

Immunogen Recombinant protein corresponding to alcohol dehydrogenase 6 (class V) Sequence AKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHEG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen Recombinant protein corresponding to alcohol dehydrogenase 6 (class V) Sequence VADYMAEKLNLDPLITHTLNLDKINEAVELMKTGKW Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Specificity This antibody is specific for Synacthen (1-24 ACTH) and has no cross reaction with CLIP (ACTH 17-39). The antibody has an affinity constant greater than 10E11 L/mol.