Theophylline

Formula: C264H406N80O77S3 Formula weight: 6028.72 CAS Number: 148498-78-6 Harmonized Tariff Code:  2937.19

Formula: C200H308N58O59S2 Formula weight: 4533.06 CAS Number: 154765-05-6 Harmonized Tariff Code:  2937.19

Amino Acid Sequence Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 General

Amino Acid Sequence Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 Biochem/physiol Actions Adrenomedullin Fragment 22-52 [ADM22-52] is used as an adrenomedullin (ADM)

Amino Acid Sequence Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 Biochem/physiol Actions Adrenomedullin Fragment 22-52 [ADM22-52] is used as an adrenomedullin (ADM)

Immunogen Recombinant protein corresponding to synaptotagmin 5 Sequence CRRRTGKKSQAQAQVHLQEVKGLGQSYIDKVQPEVEELEPAPS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

MF: C11H15NO3 MF: 209.25 CAS: 949-67-7 Purity: >99% by TLC

MF: C9H11NO3 MF: 181.19 CAS: 60-18-4 Purity: >99%

Packaging This product may be available from bulk stock and can be packaged on demand. For information on pricing, availability and packaging, please contact Stable Isotopes Customer Service .

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the