-
HPA040688-100UL
Sigma-Aldrich
Anti-EEF1G antibody produced in rabbit (C15-1456-304)
Price: $928.29List Price: $1,031.43Immunogen eukaryotic translation elongation factor 1 gamma recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
HPA055316-100UL
Sigma-Aldrich
Anti-EEF1G antibody produced in rabbit (C15-1461-977)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to eukaryotic translation elongation factor 1 gamma Sequence YTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDI Application All Prestige Antibodies -
HPA040534-100UL
Sigma-Aldrich
Anti-EEF2 antibody produced in rabbit (C15-1456-247)
Price: $928.29List Price: $1,031.43Immunogen eukaryotic translation elongation factor 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA057351-100UL
Sigma-Aldrich
Anti-EEF2 antibody produced in rabbit (C15-1462-637)
Price: $928.29List Price: $1,031.43Immunogen eukaryotic translation elongation factor 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA037410-100UL
Sigma-Aldrich
Anti-EIF4EBP2 antibody produced in rabbit (C15-1454-695)
Price: $928.29List Price: $1,031.43Immunogen eukaryotic translation initiation factor 4E binding protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA061665-100UL
Sigma-Aldrich
Anti-EIF4EBP2 antibody produced in rabbit (C15-1463-872)
Price: $928.29List Price: $1,031.43Immunogen eukaryotic translation initiation factor 4E binding protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA045537-100UL4E-BP3 (eIF4E-binding protein 3) belongs to the eukaryotic initiation factor 4E-binding protein family. It has three exons (A, B and C) and two introns.
-
HPA000609-100ULImmunogen Emerin recombinant protein epitope signature tag (PrEST) Application Anti-EMD antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by
-
HPA028360-100UL
Sigma-Aldrich
Anti-ETHE1 antibody produced in rabbit (C15-1451-794)
Price: $879.43List Price: $977.14Immunogen ethylmalonic encephalopathy 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA029028-100UL
Sigma-Aldrich
Anti-ETHE1 antibody produced in rabbit (C15-1452-097)
Price: $879.43List Price: $977.14Immunogen ethylmalonic encephalopathy 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA029029-100UL
Sigma-Aldrich
Anti-ETHE1 antibody produced in rabbit (C15-1452-098)
Price: $879.43List Price: $977.14ETHE1 (persulfide/sulfur dioxygenase) is a member of metallo-β-lactamase superfamily. It codes for a β-lactamase–like, iron-coordinating metalloprotein. -
A4596-10ML
Sigma-Aldrich
ANTI-FLAG(R) M1 Agarose Affinity Gel (C15-1315-200)
Price: $4,483.52List Price: $4,981.68ANTI-FLAG ® M1 Agarose Affinity Gel is a purified mouse IgG2B monoclonal antibody covalently attached to agarose. Specificity Binding specificity: Free N-Terminus of FLAG sequence N-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-C Application For