Electrophoresis Reagents

ETHE1 (persulfide/sulfur dioxygenase) is a member of metallo-&#946-lactamase superfamily. It codes for a &#946-lactamase–like, iron-coordinating metalloprotein.

ANTI-FLAG &#174 M1 Agarose Affinity Gel is a purified mouse IgG2B monoclonal antibody covalently attached to agarose. Specificity Binding specificity: Free N-Terminus of FLAG sequence N-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-C Application For

ANTI-FLAG &#174 M1 Agarose Affinity Gel is a purified mouse IgG2B monoclonal antibody covalently attached to agarose. Specificity Binding specificity: Free N-Terminus of FLAG sequence N-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-C Application For

ANTI-FLAG &#174 M1 Agarose Affinity Gel is a purified mouse IgG2B monoclonal antibody covalently attached to agarose. Specificity Binding specificity: Free N-Terminus of FLAG sequence N-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-C Application For

ANTI-FLAG &#174 M1 Agarose Affinity Gel is a purified mouse IgG2B monoclonal antibody covalently attached to agarose. Specificity Binding specificity: Free N-Terminus of FLAG sequence N-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-C Application For

Immunogen isocitrate dehydrogenase 3 (NAD+) beta recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen isocitrate dehydrogenase 3 (NAD+) beta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen interaction protein for cytohesin exchange factors 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to interaction protein for cytohesin exchange factors 1 Sequence VERASECKKKHAFKISHPQIKTFYFAAENVQEMNVWLNKLGSAVIHQESTTKDEECYSESEQEDPEIAAET Application All Prestige Antibodies Powered by Atlas Antibodies are

Lamp2s (lysosome-associated membrane protein gene) is located in the lysosomal lumen and lysosomal membrane. However, upon chronic acidosis in the tumour microenvironment, it is found to be present in the plasma membrane.

Immunogen lysosomal associated membrane protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

LAMP2 (lysosome-associated membrane protein 2) is a heavily glycosylated intrinsic protein (110kD) present in lysosomal membrane. The protein glycosylation is essential for its function to protect the lysosomal membrane from proteolytic enzymes.