Immunoelectrophoresis Kit Components

Immunogen isocitrate dehydrogenase 3 (NAD+) beta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen interaction protein for cytohesin exchange factors 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to interaction protein for cytohesin exchange factors 1 Sequence VERASECKKKHAFKISHPQIKTFYFAAENVQEMNVWLNKLGSAVIHQESTTKDEECYSESEQEDPEIAAET Application All Prestige Antibodies Powered by Atlas Antibodies are

Lamp2s (lysosome-associated membrane protein gene) is located in the lysosomal lumen and lysosomal membrane. However, upon chronic acidosis in the tumour microenvironment, it is found to be present in the plasma membrane.

Immunogen lysosomal associated membrane protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

LAMP2 (lysosome-associated membrane protein 2) is a heavily glycosylated intrinsic protein (110kD) present in lysosomal membrane. The protein glycosylation is essential for its function to protect the lysosomal membrane from proteolytic enzymes.

Immunogen penta-EF-hand domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Recombinant protein fragment of Human ECE1 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag. Application Suitable as a blocking agent using corresponding antibodies.

Recombinant protein fragment of Human ECE1 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag. Application Suitable as a blocking agent using corresponding antibodies.

Recombinant protein fragment of Human ECI1 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag. Application Suitable as a blocking agent using corresponding antibodies.

Recombinant protein fragment of Human ECI1 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag. Application Suitable as a blocking agent using corresponding antibodies.

Recombinant protein fragment of Human EEFSEC with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag. Application Suitable as a blocking agent using corresponding antibodies.