Cell Biology Kits

Anti-c-myc is a monoclonal antibody to c-myc peptide (clone 9E10). Anti-c-myc recognizes the 9E10 epitope sequence (EQKLISEEDL), derived from the human c-myc protein.

General description This product is a conjugate of activated magnetic cross-linked agarose beads to a polyclonal antibody that was raised against the c-Myc sequence. The c-Myc peptide tag sequence (EQKLISEEDL) is an epitope that is located within

Immunogen Recombinant protein corresponding to CASK interacting protein 2 Sequence APWAFSYLAGPPATPPDPPRPKRRSHSLSRPGPTEGDAEGEAEGPVGSTLGSYATLTRRPGRSALVRTSPSVTPTPARGTPRSQSFALR Application All Prestige Antibodies Powered by Atlas Antibodies are

General description Chromatin licensing and DNA replication factor 1/Cdc10-dependent transcript 1 (CDT1), a G1-specific cell-cycle factor, belongs to the pre-replication complex (pre-RC). The CDT1 gene is located on the human chromosome 16q24.

Chromogranin B (CHGB) is a water-soluble acidic glycoprotein that is present in almost all endocrine, neuroendocrine and neuronal tissue. It functions as a specific neuroendocrine (NE) marker in cells and tumors.

General description Connexins are highly homologous proteins that assemble as hexamers (connexons) to form gap junctions, small channels which allow for the passage of ions and other small molecules up to 1,200 daltons between neighboring cells.

General description Connexin 45 is member of a family of gap junction proteins known as Connexin gene family. It is expressed in a wide variety of cell types during development and adult life, particularly in cardiac and smooth muscle tissues as

Specificity Clone 4F11 is a mouse monoclonal antibody that detects Cortactin. Immunogen Mixture of affinity-purified tyrosine phospho-proteins from chick embryo fibroblasts expressing activated pp60src Reconstitution 0.

Specificity Clone 4F11 is a mouse monoclonal antibody that detects Cortactin. Immunogen Mixture of affinity-purified tyrosine phospho-proteins from chick embryo fibroblasts expressing activated pp60src Reconstitution 0.

CREB-regulated transcription co-activator 2 (CRTC2) is also known as TORC&nbsp(transducer of regulated CREB). Immunogen CREB regulated transcription coactivator 2 recombinant protein epitope signature tag (PrEST) Application All Prestige

Immunogen Recombinant protein corresponding to crystallin gamma D Sequence REDYRGQMIEFTEDCSCLQDRFRFNEI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to CTD phosphatase subunit 1 Sequence IFSGLHPTNFPIEKTREHYHATALGAKILTRLVLSPDAPDRATHLIAARAGTEKVLQAQECGHLHVVNPDWLWSCLERWDKVEEQLFPLRDDHTK Application All Prestige Antibodies Powered by Atlas Antibodies are