Apoptosis Detection Kits

Absorbance Detector 10mm Cell Linearity Test Kit

Immunogen APC membrane recruitment protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen apolipoprotein C3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Recombinant protein corresponding to adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1. Sequence KIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNR Application All

BTK (Bruton tyrosine kinase) belongs to the Src-related Tec family of protein tyrosine kinases and majorly involved with the development, differentiation and signaling of B lymphocyte cell lineage. It comprises of a pleckstrin-homology (PH) domain

Immunogen Recombinant protein corresponding to CASK interacting protein 2 Sequence APWAFSYLAGPPATPPDPPRPKRRSHSLSRPGPTEGDAEGEAEGPVGSTLGSYATLTRRPGRSALVRTSPSVTPTPARGTPRSQSFALR Application All Prestige Antibodies Powered by Atlas Antibodies are

CREB-regulated transcription co-activator 2 (CRTC2) is also known as TORC&nbsp(transducer of regulated CREB). Immunogen CREB regulated transcription coactivator 2 recombinant protein epitope signature tag (PrEST) Application All Prestige

Immunogen Recombinant protein corresponding to CTD phosphatase subunit 1 Sequence IFSGLHPTNFPIEKTREHYHATALGAKILTRLVLSPDAPDRATHLIAARAGTEKVLQAQECGHLHVVNPDWLWSCLERWDKVEEQLFPLRDDHTK Application All Prestige Antibodies Powered by Atlas Antibodies are

The gene DNA fragmentation factor subunit &#945 (DFFA) is mapped to human chromosome 1p36.2.

Immunogen E2F transcription factor 5, p130-binding Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen E2F transcription factor 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the