Cell Biology Reagents

Immunogen Synthetic peptide directed towards the N terminal region of human ARID5A Biochem/physiol Actions Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles in development,

Immunogen Synthetic peptide directed towards the middle region of human ARL5A Sequence Synthetic peptide located within the following region: YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the C terminal region of human ARL6IP2 Biochem/physiol Actions ARL6IP2 is a multi-pass membrane proteinPotential. It belongs to the GBP family.

Immunogen Synthetic peptide directed towards the N terminal of human ARPC4 Biochem/physiol Actions Arpc4 functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an

Immunogen Synthetic peptide directed towards the N terminal region of human ASCL1 Biochem/physiol Actions ASCL1 encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding

Immunogen Synthetic peptide directed towards the C terminal region of mouse ASCL2 Biochem/physiol Actions This is mouse homolog of ASCL2. It is a member of the basic helix-loop-helix (BHLH) family of transcription factors.

ASF1a (anti-silencing function 1a) is a histone H3/H4 chaperone and chromatin regulator. This protein facilitates histone placement and histone removal and exchange during nucleosome assembly/disassembly and is essential for the formation of

Immunogen Synthetic peptide directed towards the middle region of Human ASGR1 Biochem/physiol Actions ASGR1 is a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles

General description The protein encoded by this gene is involved in the synthesis of asparagine. This gene complements a mutation in the temperature-sensitive hamster mutant ts11, which blocks progression through the G1 phase of the cell cycle at

Immunogen Synthetic peptide directed towards the C terminal region of human ATAD1 Sequence Synthetic peptide located within the following region: KQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVR Physical form Purified antibody supplied in

General description Autophagy is a process of bulk protein degradation in which cytoplasmic components, including organelles, are enclosed in double-membrane structures called autophagosomes and delivered to lysosomes or vacuoles for degradation.

ATG16L is a component of a large protein complex that is critical for autophagy. Autophagy-related 16-like 1 (ATG16L1) is an autophagy gene, that is expressed in the colon, small intestine, intestinal epithelial cells, leukocytes and spleen.