Cell Biology Reagents

C-X-C chemokine receptor type 5 (CXCR5 Burkitt lymphoma receptor 1 Monocyte-derived receptor 15) is a G-protein coupled cytokine receptor that binds selectively to the CXCL13 (B lymphocyte chemoattractant) ligand, and mediates the development and

Immunogen Synthetic peptide directed towards the middle region of human C12orf53 Sequence Synthetic peptide located within the following region: VWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSDSMRGDGDGLI Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the middle region of human C14orf129 Sequence Synthetic peptide located within the following region: GYAFDQVDDHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEALKRDGQ Physical form Purified antibody supplied in

EPOP (elongin BC and polycomb repressive complex 2) is also known as C17orf96, esPRC2p48, E130012A19Rik. EPOP located on human chromosome 17q12.

Immunogen Synthetic peptide directed towards the middle region of human C19orf45 Sequence Synthetic peptide located within the following region: QALPGPPALRCKRASSGVELGDCKISYGSTCSEQKQAYRPQDLPEDRYDK Physical form Purified antibody supplied in 1x

Immunogen C1q and tumor necrosis factor related protein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Anti-C1QTNF9 C1q and tumor necrosis factor related protein 9

Immunogen Synthetic peptide directed towards the C terminal region of human C20orf30 Sequence Synthetic peptide located within the following region: KGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD Physical form Purified antibody supplied in

Immunogen Synthetic peptide directed towards the N terminal region of human C21orf2 Sequence Synthetic peptide located within the following region: KLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNS Physical form Purified antibody supplied in

Immunogen Synthetic peptide directed towards the C terminal region of human C2orf28 Biochem/physiol Actions The exact function of C2orf28 remains unknown.This gene is thought to be involved in apoptosis, and may also be involved in hematopoietic

C3ORF31 (TAMM41 or TAM41) codes for a mitochondrial translocator assembly and maintenance protein. Rabbit Anti-C3ORF31 antibody recognizes bovine and human C3ORF31.

Immunogen Synthetic peptide directed towards the C terminal region of human C3orf59 Sequence Synthetic peptide located within the following region: QSDGGDPNQPDDRLAKKLQQLVTENPGKSISVFINPDDVTRPHFRIDDKF Physical form Supplied at 0.5 mg/ml in