Cell Biology Reagents

General description The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are

Anti-CGREF1 cell growth regulator with EF-hand domain 1, 100

The gene chondroadherin (CHAD) has been mapped to human chromosome 17q21.33.

Immunogen Synthetic peptide directed towards the middle region of human CHI3L1 Biochem/physiol Actions CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in

Immunogen Synthetic peptide directed towards the N terminal region of human CHIC2 Application Anti-CHIC2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25&#956g/mL.

Immunogen Synthetic peptide directed towards the N terminal region of human CHIC2 Biochem/physiol Actions CHIC2 is a member of the CHIC family of proteins. This protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to

General description Interleukin-17F (UniProt: Q7TNI7: also known as IL-17F) is encoded by the Il17f gene (Gene ID: 257630) in murine species. The IL-17 family of cytokines contains six members that share four conserved cysteine residues at their

General description Interleukin-17F (UniProt: Q7TNI7: also known as IL-17F) is encoded by the Il17f gene (Gene ID: 257630) in murine species. The IL-17 family of cytokines contains six members that share four conserved cysteine residues at their

CHIP (carboxy terminus of Hsp70-interacting protein, also known as STIP1-homology and U-box containing protein 1, STUB1, HSPABP2, NY-CO-7, SDCCAG7, UBOX1), is a dual-function chaperone/E3 ubiquitin ligase. CHIP has 3 functional domains: a

General description Chitotriosidase is secreted by activated human macrophages and is markedly elevated in plasma of Gaucher disease patients. The expression of chitotriosidase occurs only at a late stage of differentiation of monocytes to

Immunogen Synthetic peptide directed towards the N terminal region of human CHRFAM7A Biochem/physiol Actions The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal

Immunogen Synthetic peptide directed towards the N terminal of human CHRNG. Sequence Synthetic peptide located within the following region: QEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTT Physical form Purified antibody supplied in 1x PBS buffer