Apoptosis-related Peptides

General description Mitofusins (Mfn1 and Mfn2) are the mammalian homologs of the Drosophila protein fuzzy onion (Fzo). They are transmembrane GTPases embedded in the outer membrane of mitochondria, essential for fusion of mitochondria in

Mortality factor 4 (MORF4) is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes typically by acetylation of nucleosomal histones H4 and H2A. NuA4 complex may be required

Immunogen mortality factor 4 like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Synthetic peptide directed towards the C terminal region of human MOSPD3 Application Anti-MOSPD3 antibody produced in rabbit is suitable for western blotting at a concentration of 5.0&#956g/ml and for immunohistochemistry of

Immunogen Synthetic peptide directed towards the N terminal region of human MTCH2 Biochem/physiol Actions MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats.

Immunogen Synthetic peptide directed towards the middle region of human MVK Sequence Synthetic peptide located within the following region: KEDLELINKWAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSP Physical form Purified antibody supplied in 1x PBS

General description The protein encoded by this gene is a kinase required for progression through the metaphase portion of mitosis. Inhibition of the encoded protein can lead to apoptosis.

Immunogen Synthetic peptide directed towards the middle region of human NKD1 Biochem/physiol Actions In the mouse, Nkd is a Dishevelled -binding protein that functions as a negative regulator of the Wnt-beta-catenin -Tcf signaling pathway.

General description NSMCE4A is a component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin

Immunogen Synthetic peptide directed towards the N terminal region of human OLR1 Application Anti-OLR1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5&#956g/ml.

Immunogen Synthetic peptide directed towards the middle region of human OMP Sequence Synthetic peptide located within the following region: WRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKA Physical form Purified antibody supplied in 1x PBS

Immunogen Synthetic peptide directed towards the N terminal region of human OPRK1 Sequence Synthetic peptide located within the following region: DSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEP Physical form Purified antibody supplied in