Apoptosis-related Peptides

Immunogen Synthetic peptide directed towards the middle region of human ARCN1 Application Anti-ARCN1 antibody produced in rabbit is suitable for western blotting at a concentration of 1&#956g/mL. Biochem/physiol Actions ARCN1 gene encodes an

General description This gene is a member of the human ADP-ribosylation factor (ARF) gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in

Immunogen Synthetic peptide directed towards the middle region of human ARL5A Sequence Synthetic peptide located within the following region: YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the N terminal region of human ASCL1 Biochem/physiol Actions ASCL1 encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding

Immunogen Synthetic peptide directed towards the C terminal region of mouse ASCL2 Biochem/physiol Actions This is mouse homolog of ASCL2. It is a member of the basic helix-loop-helix (BHLH) family of transcription factors.

ATG16L is a component of a large protein complex that is critical for autophagy. Autophagy-related 16-like 1 (ATG16L1) is an autophagy gene, that is expressed in the colon, small intestine, intestinal epithelial cells, leukocytes and spleen.

Immunogen Synthetic peptide directed towards the C terminal region of human ATG5 Biochem/physiol Actions ATG5 is required for autophagy. It conjugates to ATG12 and associates with isolation membrane to form cup-shaped isolation membrane and

General description The protein encoded by this gene, in combination with autophagy protein 12, functions as an E1-like activating enzyme in a ubiquitin-like conjugating system. The encoded protein is involved in several cellular processes,

General description This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of

General description This gene was first characterized as part of a cluster of genes located within the human major histocompatibility complex class III region. This gene encodes a nuclear protein that is cleaved by caspase 3 and is implicated in

Immunogen Synthetic peptide directed towards the C terminal region of human C2orf28 Biochem/physiol Actions The exact function of C2orf28 remains unknown.This gene is thought to be involved in apoptosis, and may also be involved in hematopoietic

Caspase-3 (CASP3) belongs to the class of cysteine proteases. CASP3&nbspis an executioner caspase, which is cleaved and activated with the help of caspase-8 and caspase-9 initiator caspases.