Apoptosis-related Peptides

General description Five endoplasmic reticulum (ER)-resident proteins have been shown to function as receptors for selective ER-phagy: FAM134B, SEC62, RTN3, CCPG1 and ATL3.1-2 These integral membrane proteins appear to partition into different

General description Five endoplasmic reticulum (ER)-resident proteins have been shown to function as receptors for selective ER-phagy: FAM134B, SEC62, RTN3, CCPG1 and ATL3.1-2 These integral membrane proteins appear to partition into different

Immunogen Synthetic peptide directed towards the N terminal region of human FAM35A Sequence Synthetic peptide located within the following region: PDLSGHFLANCMNRHVHVKDDFVRSVSETQNIESQKIHSSRLSDITSSNM Physical form Purified antibody supplied in

Immunogen Synthetic peptide directed towards the middle region of human FAM38B Biochem/physiol Actions FAM38B is a multi-pass membrane proteinPotential. It belongs to the FAM38 family.

Immunogen Synthetic peptide directed towards the middle region of human FAM46C Sequence Synthetic peptide located within the following region: LIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFP Physical form Purified antibody supplied in 1x PBS

General description Fanconi anemia (FA) is an inherited bone marrow failure syndrome associated with a progressive decline in hematopoietic stem cells, developmental defects, and predisposition to cancer. FANCC is part of the multisubunit Fanconi

Specificity Fas Immunogen recombinant protein containing the cytoplasmic domain of mouse Fas Application Anti-Fas Antibody, clone 7C10 is an antibody against Fas for use in IP &amp: WB. Research Category Apoptosis &amp: Cancer Research Sub

Specificity Human FAS Ligand (FASL). The 13-mer human FASL sequence used for antibody production is 92% (12/13 AA) homologous with rat and mouse FASL.

General description This gene is a member of the tumor necrosis factor superfamily. The primary function of the encoded transmembrane protein is the induction of apoptosis triggered by binding to FAS.

Immunogen Synthetic peptide directed towards the middle region of mouse Fbxw7 Biochem/physiol Actions Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and

Immunogen Synthetic peptide directed towards the N terminal region of human FLT3LG Biochem/physiol Actions FLT3LG stimulates the proliferation of early hematopoietic cells and synergizes well with a number of other colony stimulating factors and

General description The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1.