Other Peptides

Immunogen Synthetic peptide directed towards the N terminal of human Klf2 Biochem/physiol Actions Klf2 binds to the CACCC box in the beta-globin gene promoter and activates transcription. Sequence Synthetic peptide located within the following

Immunogen Synthetic peptide directed towards the N terminal of human KLF4 Sequence Synthetic peptide located within the following region: MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRPAGAPTNRWREELSH Physical form Purified antibody supplied in 1x PBS

Immunogen Synthetic peptide directed towards the C terminal region of human LANCL3 Sequence Synthetic peptide located within the following region: ICHGVAGSAYVFLLLYRLTGNSKYIYRAQSSFPVNLIKMEHLLYTRQHCF Physical form Purified antibody supplied in

Immunogen Synthetic peptide directed towards the middle region of human LARP6 Sequence Synthetic peptide located within the following region: MGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC Physical form Purified antibody supplied in 1x

General description This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans

Immunogen Synthetic peptide directed towards the N terminal region of human LIN9 Application Anti-LIN9 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5&#956g/ml.

Immunogen The immunogen for anti-LIPC antibody: synthetic peptide derected towards the C terminal of human LIPC Sequence Synthetic peptide located within the following region: GDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFKVY Physical form

Immunogen Synthetic peptide directed towards the C terminal region of human LMAN2 Application Anti-LMAN2 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25&#956g/mL.

General description This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the

Immunogen Synthetic peptide directed towards the middle region of human LPCAT1 Application Anti-LPCAT1 antibody produced in rabbit is suitable for immunohistochemistry (formalin-fixed, paraffin-embedded sections) and western blot applications.

Immunogen Synthetic peptide directed towards the N terminal region of human LRRC25 Biochem/physiol Actions LRRC25 is a single-pass type I membrane protein. It contains 2 LRR (leucine-rich) repeats.

Immunogen Synthetic peptide directed towards the N terminal region of human LRRC52 Sequence Synthetic peptide located within the following region: QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC Physical form Purified antibody supplied in