Other Peptides

Immunogen Synthetic peptide directed towards the middle region of human NFIC Sequence Synthetic peptide located within the following region: MLAPPPPGLPRLALPPATKPATTSEGGATSPTSPSYSPPDTSPANRSFVG Physical form Purified antibody supplied in 1x PBS

NFYA is a nuclear transcription factor that forms a regulatory subunit of the trimeric complex of NF-Y that associates with CCAAT motifs in cell cycle progression genes. Hence, this gene has been implicated in cell proliferation.

General description This gene is predominantly expressed in the testis and lymphocyte-rich areas of spleen and lymph nodes. It encodes a calcium-dependen NADPH oxidase that generates superoxide, and functions as a calcium-dependent proton channel

General description This gene is predominantly expressed in the testis and lymphocyte-rich areas of spleen and lymph nodes. It encodes a calcium-dependen NADPH oxidase that generates superoxide, and functions as a calcium-dependent proton channel

General description This gene is predominantly expressed in the testis and lymphocyte-rich areas of spleen and lymph nodes. It encodes a calcium-dependen NADPH oxidase that generates superoxide, and functions as a calcium-dependent proton channel

General description This gene is predominantly expressed in the testis and lymphocyte-rich areas of spleen and lymph nodes. It encodes a calcium-dependen NADPH oxidase that generates superoxide, and functions as a calcium-dependent proton channel

Immunogen Synthetic peptide directed towards the N terminal region of human NR2F6 Sequence Synthetic peptide located within the following region: AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV Physical form Purified antibody supplied in 1x PBS

Immunogen Synthetic peptide directed towards the C terminal of human Nr4a3 Biochem/physiol Actions Nr4a3 binds to the B1A response-element. Sequence Synthetic peptide located within the following region:

General description NUPR1 could participate in the response to proapoptotic stimuli and promotes cellular growth in a way that helps the tissue counteract diverse injuries. NUPR1 may contribute to the metastatic phenotype.

General description GPR120 is a member of the rhodopsin family of G protein-coupled receptors (GPRs). Sequence Synthetic peptide located within the following region: VVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIM Physical form Supplied at

Immunogen Synthetic peptide directed towards the middle region of human ONECUT2 Biochem/physiol Actions ONECUT2 belongs to onecut family of transcription factors that regulate melanocyte and hepatocyte differentiation. Sequence Synthetic peptide

Immunogen Synthetic peptide directed towards the C terminal region of human OPN1SW Sequence Synthetic peptide located within the following region: SESYTWFLFIFCFIVPLSLICFSYTQLLRALKAVAAQQQESATTQKAERE Physical form Purified antibody supplied in