Other Peptides

Immunogen A phospho synthetic peptide corresponding to residues surrounding S320 of human CTNND1. Physical form PBS with 0.

Immunogen A phospho synthetic peptide corresponding to residues surrounding Y904 of human CTNND1. Physical form PBS with 0.

General description Piezos are large transmembrane proteins conserved among various species, all having between 24 and 36 predicted transmembrane domains. &#8242:Piezo&#8242: comes from the Greek &#8242:piesi,&#8242: meaning &#8242:pressure.

Immunogen Synthetic peptide directed towards the middle region of human PIN4 Sequence Synthetic peptide located within the following region: LGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK Physical form Purified antibody supplied in 1x PBS

Immunogen Synthetic peptide directed towards the middle region of human PLAC9 Sequence Synthetic peptide located within the following region: RRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDG Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the middle region of human PLP2 Biochem/physiol Actions PLP2 may play a role in cell differentiation in the intestinal epithelium. Sequence Synthetic peptide located within the following region:

Immunogen Synthetic peptide directed towards the N terminal region of human PUM2 Biochem/physiol Actions PUM2 is a sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3&#8242-UTR of mRNA targets. Its

General description RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the

Immunogen Synthetic peptide directed towards the middle region of human RAD23B Sequence Synthetic peptide located within the following region: QMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAG Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the middle region of human RBM24 Sequence Synthetic peptide located within the following region: VTAGGYGYAVQQPITAAAPGTAAAAAAAAAAAAAFGQYQPQQLQTDRMQ Disclaimer Unless otherwise stated in our catalog

Immunogen Synthetic peptide directed towards the middle region of human RBM45 Biochem/physiol Actions RBM45 is a RNA-binding protein with binding specificity for poly(C). It May play an important role in neural development.

Immunogen Synthetic peptide directed towards the middle region of human RBX1 Application Anti-RBX1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 &#956g/ml. Biochem/physiol Actions RBX1 is a component of SCF