Other Peptides

Immunogen Synthetic peptide directed towards the C terminal of human RCOR2 Biochem/physiol Actions Rcor2 may act as a component of a corepressor complex that represses transcription potential. Sequence Synthetic peptide located within the

Immunogen Synthetic peptide directed towards the middle region of human RGS5 Sequence Synthetic peptide located within the following region: PDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKS Physical form Purified antibody supplied in 1x

The previously assigned protein identifier Q76LB3 has been merged into Q8TB24. Full details can be found on the UniProt database.

Immunogen Synthetic peptide directed towards the C terminal region of human RNF148 Biochem/physiol Actions RNF148 is a single-pass membrane protein. It contains 1 PA (protease associated) domain and 1 RING-type zinc finger.

Immunogen Synthetic peptide directed towards the middle region of human RNF182 Biochem/physiol Actions RNF182 is a multi-pass membrane protein. It contains 1 RING-type zinc finger.

Immunogen Synthetic peptide directed towards the N terminal region of human RNF182 Biochem/physiol Actions RNF182 is a multi-pass membrane protein. It contains 1 RING-type zinc finger.

Immunogen The immunogen for anti-RPL26 antibody: synthetic peptide derected towards the middle region of human RPL26 Sequence Synthetic peptide located within the following region: GQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDK Physical

Immunogen Synthetic peptide directed towards the middle region of Rpl32 Sequence Synthetic peptide located within the following region: GSNKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKA Physical form Purified antibody supplied in 1x PBS

Immunogen Synthetic peptide directed towards the middle region of human RPL37A Sequence Synthetic peptide located within the following region: CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the middle region of human RUNX1T1 Sequence Synthetic peptide located within the following region: RQCNLQQFIQQTGAALPPPPRPDRGPPGTQGPLPPAREESLLGAPSESHA Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the C terminal of human RUNX2 Sequence Synthetic peptide located within the following region: PCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY Physical form Purified antibody supplied in 1x PBS

General description The protein encoded by this gene is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. This protein is found primarily in cardiac muscle and is responsible for the initial upstroke of