Other Peptides

ACQUITY Premier Peptide BEH C18 Column, 300 …, 1.7 µm, 2.1 x 100 mm, with VanGuard FIT, 1/pk

ACQUITY Premier Peptide BEH C18 Column, 300 …, 1.7 µm, 2.1 x 150 mm, with VanGuard FIT, 1/pk

ACQUITY Premier Peptide BEH C18 Column, 300Å, 1.7 µm, 2.1 x 50 mm, 1/pk

ACQUITY Premier Peptide BEH C18 Column, 300Å, 1.7 µm, 2.1 x 100 mm, 1/pk

ACQUITY Premier Peptide BEH C18 Column, 300Å, 1.7 µm, 2.1 x 150 mm, 1/pk

ACQUITY UPLC Peptide HSS T3 VanGuard Pre-column, 100Å, 1.8 µm, 2.1 mm X 5 mm, 1K - 15K, 3/pk

Albumin constitutes 25% of the proteins produced by the liver and is a prominent protein found in the blood. It is a protein of a single polypeptide chain with a thiol group.

Albumin constitutes 25% of the proteins produced by the liver and is a prominent protein found in the blood. It is a protein of a single polypeptide chain with a thiol group.

Immunogen Synthetic peptide directed towards the middle region of human A4GALT Biochem/physiol Actions The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been

General description Histone H3 is one of the five main histone proteins involved in the structure of chromatin in eukaryotic cells. Featuring a main globular domain and a long N-terminal tail, H3 is involved with the structure of the nucleosomes

Immunogen Synthetic peptide directed towards the middle region of human ACTR1A Sequence Synthetic peptide located within the following region: AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP Physical form Purified antibody supplied in 1x

Immunogen The immunogen for anti-ADAMTS6 antibody: synthetic peptide derected towards the C terminal of human ADAMTS6 Sequence Synthetic peptide located within the following region: PWSECSATCAGGVQRQEVVCKRLDDNSIVQNNYCDPDSKPPENQRACNTE Physical