Other Peptides

Immunogen Synthetic peptide directed towards the N terminal region of human ANXA7 Biochem/physiol Actions ANXA7 is a calcium-dependent, phospholipid-binding protein that belongs to the annexin family. It is expressed as 47 and 51 kDa isoforms that

Immunogen Synthetic peptide directed towards the middle region of human AQP2 Biochem/physiol Actions Aqp2 forms a water-specific channel that provides the plasma membranes of renal collecting duct with high permeability to water, thereby

Immunogen Synthetic peptide directed towards the C terminal region of human ARID5A Biochem/physiol Actions Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles in development,

Immunogen Synthetic peptide directed towards the N terminal region of human ARID5A Biochem/physiol Actions Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles in development,

Immunogen Synthetic peptide directed towards the C terminal region of human ARL6IP2 Biochem/physiol Actions ARL6IP2 is a multi-pass membrane proteinPotential. It belongs to the GBP family.

Immunogen Synthetic peptide directed towards the N terminal of human ARPC4 Biochem/physiol Actions Arpc4 functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an

Immunogen Synthetic peptide directed towards the middle region of Human ASGR1 Biochem/physiol Actions ASGR1 is a cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles

Immunogen Synthetic peptide directed towards the C terminal region of human ATAD1 Sequence Synthetic peptide located within the following region: KQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVR Physical form Purified antibody supplied in

Immunogen Synthetic peptide directed towards the middle region of human BBX Biochem/physiol Actions BBX is a transcription factor that is necessary for cell cycle progression from G1 to S phase. Sequence Synthetic peptide located within the

General description This gene encodes the cytosolic form of the enzyme branched-chain amino acid transaminase. This enzyme catalyzes the reversible transamination of branched-chain alpha-keto acids to branched-chain L-amino acids essential for

General description The previously assigned protein identifier B5MDI8 has been merged into Q8N1M1. Full details can be found on the UniProt database.

Polyclonal antibody for APP detection. Host: Rabbit.