Other Peptides

Immunogen Synthetic peptide directed towards the middle region of human SLCO1A2 Biochem/physiol Actions SLCO1A2 is a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids,

Immunogen Synthetic peptide directed towards the middle region of human SLCO5A1 Biochem/physiol Actions This gene encodes a 12 transmembrane domain protein that is a member of the solute carrier organic anion transporter superfamily. Alternative

Immunogen Synthetic peptide directed towards the N terminal region of human SNAI1 Biochem/physiol Actions The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes

Immunogen The immunogen for anti-SQRDL antibody: synthetic peptide derected towards the C terminal of human SQRDL Sequence Synthetic peptide located within the following region: AQSGILDRTMCLIMKNQRPIKKYDGYTSCPLVTGYNRVILAEFDYTAQPL Physical form

Immunogen Synthetic peptide directed towards the middle region of human SREBF2 Sequence Synthetic peptide located within the following region: VMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIEL Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the middle region of human SRP54 Biochem/physiol Actions SRP54 belongs to the GTP-binding SRP family. It binds to the signal sequence of presecretory protein when they emerge from the ribosomes and

General description SRRM2 is involved in pre-mRNA splicing. It may function at or prior to the first catalytic step of splicing at the catalytic center of the spliceosome and may do so by stabilizing the catalytic center or the position of the RNA

General description SRRM2 is involved in pre-mRNA splicing. It may function at or prior to the first catalytic step of splicing at the catalytic center of the spliceosome and may do so by stabilizing the catalytic center or the position of the RNA

General description SRRM2 is involved in pre-mRNA splicing. It may function at or prior to the first catalytic step of splicing at the catalytic center of the spliceosome and may do so by stabilizing the catalytic center or the position of the RNA

General description SRRM2 is involved in pre-mRNA splicing. It may function at or prior to the first catalytic step of splicing at the catalytic center of the spliceosome and may do so by stabilizing the catalytic center or the position of the RNA

Immunogen Synthetic peptide directed towards the C terminal of human STK25 Sequence Synthetic peptide located within the following region: TKKTSFLTELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPP Physical form Purified antibody supplied in 1x PBS

Immunogen Synthetic peptide directed towards the N terminal region of human SUPT3H Application Anti- SUPT3H antibody produced in rabbit is suitable for western blotting at a concentration of 0.4 &#956g/ml.