Other Peptides

Immunogen Synthetic peptide directed towards the N terminal region of human SYCP1 Sequence Synthetic peptide located within the following region: NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV Physical form Purified antibody supplied in

Immunogen Synthetic peptide directed towards the middle region of human SYT9 Biochem/physiol Actions SYT9 may be involved in Ca2+-dependent exocytosis of secretory vesicles through Ca2+ and phospholipid binding to the C2 domain or may serve as

General description This gene encodes a member of the transforming acidic colied-coil protein family. The encoded protein is a motor spindle protein that may play a role in stabilization of the mitotic spindle.

Immunogen Synthetic peptide directed towards the middle region of human TAF7 Sequence Synthetic peptide located within the following region: AKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLE Physical form Purified antibody supplied in 1x PBS

Immunogen Synthetic peptide directed towards the C terminal region of human TBX18 Biochem/physiol Actions TBX18 is a probable transcriptional regulator involved in developmental processes. Sequence Synthetic peptide located within the

Immunogen Synthetic peptide directed towards the middle region of human TDRD9 Biochem/physiol Actions TDRD9 contains 1 helicase ATP-binding domain and 1 helicase C-terminal domain. The exact function of TDRD9 is not known.

Immunogen Synthetic peptide directed towards the C-terminal region of Human PAPD5 Sequence Synthetic peptide located within the following region: SSSKGFQGTTQTSHGSLMTNKQHQGKSNNQYYHGKKRKHKRDAPLSDLCR Physical form Supplied at 0.5 mg/ml in

Immunogen Synthetic peptide directed towards the C-terminal region of Human PAPD5 Sequence Synthetic peptide located within the following region: SSSKGFQGTTQTSHGSLMTNKQHQGKSNNQYYHGKKRKHKRDAPLSDLCR Physical form Supplied at 0.5 mg/ml in

Immunogen Synthetic peptide directed towards the N terminal region of human TEX2 Application Anti-TEX2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5&#956g/ml.

Immunogen Synthetic peptide directed towards the middle region of human TEX264 Biochem/physiol Actions The specific function of TEX264 is not yet known. Sequence Synthetic peptide located within the following region:

Immunogen Synthetic peptide directed towards the N terminal region of human TFDP2 Biochem/physiol Actions The TFDP genes encode a family of transcription factors that can form heterodimers with E2F family proteins in vivo. The E2F-TFDP

Immunogen Synthetic peptide directed towards the N terminal region of human TLX3 Biochem/physiol Actions RNX (HOX11L2, TLX3) belongs to a family of orphan homeobox genes that encode DNA-binding nuclear transcription factors. Members of the HOX11