-
Add to Cart The item has been addedPRS4553-100UGANTI-UNC93B ANTIBODY PRODUCED IN RABBIT
Price: $980.46List Price: $1,089.40General description Unc93b (unc-93 homolog B1) is a multiple membrane-spanning protein, that is located in the endoplasmic reticulum. It is mainly present in the heart and also highly expressed in dendritic cells and macrophages. -
Add to Cart The item has been addedAV49979-100ULANTI-UNC93B1 (C005B-099591)
Price: $828.90List Price: $921.00Immunogen Synthetic peptide directed towards the N terminal region of human UNC93B1 Application Anti-UNC93B1 antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml. -
Add to Cart The item has been addedSAB2109214-100ULANTI-UQCC2 (C-TERMINAL) ANTIBODY PRODUCED IN RABBIT
Price: $785.86List Price: $873.18General description This gene encodes a nucleoid protein localized to the mitochondria inner membrane. The encoded protein affects regulation of insulin secretion, mitochondrial ATP production, and myogenesis through modulation of mitochondrial -
Add to Cart The item has been addedSAB2104644-100ULANTI-USF1 (C005B-330963)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the middle region of human USF1 Biochem/physiol Actions USF1 is a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. USF1 can activate -
Add to Cart The item has been addedSAB2103646-100ULANTI-USP12 (C005B-331122)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the middle region of human USP12 Sequence Synthetic peptide located within the following region: ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG Physical form Purified antibody supplied in 1x -
Add to Cart The item has been addedAV38825-100ULANTI-USP39 (C005B-098956)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the N terminal region of human USP39 Biochem/physiol Actions USP39 is a ubiquitin specific peptidase, a neuronal slicing factor expressed in the brain. It maintains embryonic pituitary homeostasis in -
Add to Cart The item has been addedSAB2105695-100ULANTI-VAMP7 (C005B-330777)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the N terminal region of human VAMP7 Biochem/physiol Actions This gene encodes a transmembrane protein that is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor -
Add to Cart The item has been addedAV50815-100ULANTI-VGLL2
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the middle region of human VGLL2 Application Anti-VGLL2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml. -
Add to Cart The item has been addedHPA054108-25Anti-VTI1A vesicle transport through interaction with t-SNAR (C003B-066036)
Price: $588.44List Price: $653.82Anti-VTI1A vesicle transport through interaction with t-SNAR -
Add to Cart The item has been addedHPA044121-25Anti-VTI1B vesicle transport through interaction with t-SNAR (C003B-062827)
Price: $588.44List Price: $653.82Anti-VTI1B vesicle transport through interaction with t-SNAR -
Add to Cart The item has been addedHPA048150-25Anti-VTI1B vesicle transport through interaction with t-SNAR (C003B-064143)
Price: $588.44List Price: $653.82Anti-VTI1B vesicle transport through interaction with t-SNAR -
Add to Cart The item has been addedHPA060118-25Anti-VTI1B vesicle transport through interaction with t-SNAR (C003B-067737)
Price: $830.56List Price: $922.85Anti-VTI1B vesicle transport through interaction with t-SNAR
