Other Peptides

Anti-VTI1B vesicle transport through interaction with t-SNAR

Anti-VTI1B vesicle transport through interaction with t-SNAR

Anti-VTI1B vesicle transport through interaction with t-SNAR

General description YTHDC1 may be part of a signal transduction pathway that influences splice site selection. Immunogen Synthetic peptide directed towards the N-terminal region of Human YTHDC1 Sequence Synthetic peptide located within the

Immunogen Synthetic peptide directed towards the C terminal region of human ZDHHC3 Sequence Synthetic peptide located within the following region: MFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASP Physical form Purified antibody supplied in

Immunogen Synthetic peptide directed towards the N terminal region of human ZFP106 Biochem/physiol Actions ZFP106 is a new candidate transcription factor Sequence Synthetic peptide located within the following region:

Immunogen Synthetic peptide directed towards the middle region of human Zfp445 Biochem/physiol Actions Zfp445 may be involved in transcriptional regulation. Sequence Synthetic peptide located within the following region:

Immunogen Synthetic peptide directed towards the middle region of human ZFP589 Biochem/physiol Actions The function of Anti-ZFP589 has not yet been determined. Sequence Synthetic peptide located within the following region:

Immunogen Synthetic peptide directed towards the N terminal region of human ZFYVE20 Biochem/physiol Actions ZFYVE20 is the Rab4/Rab5 effector protein acting in early endocytic membrane fusion and membrane trafficking of recycling endosomes.

Ascentis Express Peptide ES-C18 columns are specifically engineered to separate higher molecular weight compounds such as peptides and small proteins. These columns contain advanced Fused-Core particles that have larger pores (160 Ã… versus 90 Ãâ

Ascentis Express Peptide ES-C18 columns are specifically engineered to separate higher molecular weight compounds such as peptides and small proteins. These columns contain advanced Fused-Core particles that have larger pores (160 Ã… versus 90 Ãâ

AT-1002 TFA, a 6-mer synthetic peptide , is a tight junction regulator and absorption enhancer .Appearance:SolidIn Vitro:AT-1002, a 6-mer synthetic peptide, belongs to an emerging novel class of compounds that reversibly increase paracellular