Other Peptides

Immunogen Synthetic peptide directed towards the middle region of human BRD3 Biochem/physiol Actions BRD3 is a RING3 protein, a serine/threonine kinase. The gene localizes to 9q34, a region which contains several major histocompatibility complex

Immunogen Synthetic peptide directed towards the middle region of human C12orf53 Sequence Synthetic peptide located within the following region: VWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSDSMRGDGDGLI Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the middle region of human C14orf129 Sequence Synthetic peptide located within the following region: GYAFDQVDDHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEALKRDGQ Physical form Purified antibody supplied in

Immunogen Synthetic peptide directed towards the middle region of human C19orf45 Sequence Synthetic peptide located within the following region: QALPGPPALRCKRASSGVELGDCKISYGSTCSEQKQAYRPQDLPEDRYDK Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the C terminal region of human C20orf30 Sequence Synthetic peptide located within the following region: KGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD Physical form Purified antibody supplied in

Immunogen Synthetic peptide directed towards the N terminal region of human C21orf2 Sequence Synthetic peptide located within the following region: KLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNS Physical form Purified antibody supplied in

C3ORF31 (TAMM41 or TAM41) codes for a mitochondrial translocator assembly and maintenance protein. Rabbit Anti-C3ORF31 antibody recognizes bovine and human C3ORF31.

Immunogen Synthetic peptide directed towards the C terminal region of human C3orf59 Sequence Synthetic peptide located within the following region: QSDGGDPNQPDDRLAKKLQQLVTENPGKSISVFINPDDVTRPHFRIDDKF Physical form Supplied at 0.5 mg/ml in

Immunogen Synthetic peptide directed towards the C terminal region of human C4orf33 Biochem/physiol Actions C4orf33 belongs to the UPF0462 family. The exact function of C4orf33 remains unknown.

Immunogen Synthetic peptide directed towards the middle region of human C5orf24 Sequence Synthetic peptide located within the following region: SIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKT Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the middle region of human C5orf33 Sequence Synthetic peptide located within the following region: RWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHNRALNIERAHDERSEA Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the N terminal region of human C8orf34 Biochem/physiol Actions The exact function of C8orf34 remains unknown. Sequence Synthetic peptide located within the following region: