Other Peptides

Immunogen Synthetic peptide directed towards the middle region of human C9orf4 Sequence Synthetic peptide located within the following region: HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVP Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the N terminal region of human C9orf4 Sequence Synthetic peptide located within the following region: PAACAASPADDGAGPGGRGPRGRARGDTGADEAVPRHDSSYGTFAGEFYD Physical form Purified antibody supplied in

Immunogen Synthetic peptide directed towards the N terminal region of human CCDC67 Sequence Synthetic peptide located within the following region: RKMRALETRLDLRDQELANAQTCLDQKGQEVGLLRQKLDSLEKCNLAMTQ Physical form Purified antibody supplied in

General description This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1

General description The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member

General description The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member

General description This gene encodes a glycoprotein involved in the regulation of the complement cascade. Binding of the encoded protein to complement proteins accelerates their decay, thereby disrupting the cascade and preventing damage to host

General description This gene encodes a protein that is one of the components of the Mediator coactivator complex. The Mediator complex is a multiprotein complex required for transcriptional activation by DNA binding transcription factors of genes

General description Cdk4 is probably involved in the control of the cell cycle. Sequence Synthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE Physical form Supplied at 0.

Immunogen Synthetic peptide directed towards the middle region of human CDRT4 Sequence Synthetic peptide located within the following region: TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS Physical form Purified antibody supplied in 1x

General description This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha,

Immunogen Synthetic peptide directed towards the N terminal region of human CEBPG Biochem/physiol Actions CCAAT/enhancer binding protein (C/EBP), &#947 (CEBPG) is a transcription factor that regulates transcription mediated by CCAAT/enhancer