Other Peptides

Immunogen Synthetic peptide directed towards the N terminal region of human CEBPG Biochem/physiol Actions CCAAT/enhancer binding protein (C/EBP), &#947 (CEBPG) is a transcription factor that regulates transcription mediated by CCAAT/enhancer

Immunogen Synthetic peptide directed towards the C-terminal region of human CFLAR Sequence Synthetic peptide located within the following region: LRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the middle region of human CHI3L1 Biochem/physiol Actions CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in

Immunogen Synthetic peptide directed towards the N terminal region of human CHIC2 Application Anti-CHIC2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25&#956g/mL.

Immunogen Synthetic peptide directed towards the N terminal region of human CHIC2 Biochem/physiol Actions CHIC2 is a member of the CHIC family of proteins. This protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to

CHIP (carboxy terminus of Hsp70-interacting protein, also known as STIP1-homology and U-box containing protein 1, STUB1, HSPABP2, NY-CO-7, SDCCAG7, UBOX1), is a dual-function chaperone/E3 ubiquitin ligase. CHIP has 3 functional domains: a

General description Chitotriosidase is secreted by activated human macrophages and is markedly elevated in plasma of Gaucher disease patients. The expression of chitotriosidase occurs only at a late stage of differentiation of monocytes to

Immunogen Synthetic peptide directed towards the N terminal of human CHRNG. Sequence Synthetic peptide located within the following region: QEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTT Physical form Purified antibody supplied in 1x PBS buffer

Immunogen Synthetic peptide directed towards the N terminal region of human CIRBP Biochem/physiol Actions CIRBP contains 1 RRM (RNA recognition motif) domain. It seems to play an essential role in cold-induced suppression of cell proliferation.

Immunogen Synthetic peptide directed towards the middle region of human CITED1 Biochem/physiol Actions CBP/p300-interacting transactivator 1 (CITED1, melanocyte-specific protein 1 ) is a nuclear protein that shares two highly conserved domains,

Immunogen Synthetic peptide directed towards the N terminal region of mouse CITED4 Biochem/physiol Actions Cited4 is a member of The CITED family proteins that bind to CBP/p300 transcriptional integrators through their conserved C-terminal acidic

Immunogen Synthetic peptide directed towards the C terminal region of human CLDN18 Biochem/physiol Actions CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells.CLDN18 belongs to the large