Other Peptides

Immunogen Synthetic peptide directed towards the middle region of human CNNM2 Biochem/physiol Actions CNNM2 is a divalent metal cation transporter. CNNM2 mediates transport of divalent metal cations in an order of Mg2+ > Co2+ > Mn2+ > Sr2+ >

Immunogen Synthetic peptide directed towards the N terminal region of human CNOT4 Biochem/physiol Actions CNOT4 has E3 ubiquitin ligase activity. The CCR4-NOT complex functions as general transcription regulation complex.

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 152-421 of human CNP (NP_149124.3).

General description The protein encoded by this gene possesses kinase activity that phosphorylates regulators involved in signal transduction. It phosphorylates I kappa-Balpha, p105, and c-Jun.

Immunogen Synthetic peptide directed towards the N terminal of human CPNE5 Sequence Synthetic peptide located within the following region: SLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQ Physical form Purified antibody supplied in 1x PBS

Immunogen Synthetic peptide directed towards the N terminal region of human CRBN Sequence Synthetic peptide located within the following region: DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the C terminal region of human CSDA Sequence Synthetic peptide located within the following region: RYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRP Physical form Purified antibody supplied in 1x

General description The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought

Immunogen Synthetic peptide directed towards the C terminal region of human CSTF2T Biochem/physiol Actions CSTF2T may play a significant role in AAUAAA-independent mRNA polyadenylation in germ cells. It is directly involved in the binding to

Immunogen Synthetic peptide directed towards the N terminal region of human CTPS Application Anti-CTPS (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 5&#956g/ml and for immunohistochemistry at a

Immunogen Synthetic peptide directed towards the middle region of human CXCL12 Sequence Synthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM Physical form Purified antibody supplied in 1x

General description This gene encodes a regulator of the cell division cycle 7 homolog (S. cerevisiae) protein, a serine-threonine kinase which links cell cycle regulation to genome duplication.