Other Peptides

General description This gene encodes a nuclear transmembrane protein that associates with cullin 4A/damaged DNA binding protein 1 ubiquitin ligase complex. Mutations in this gene are associated with Woodhouse-Sakati syndrome.

Dcp2 colocalizes with Dcp1 in distinct cytoplasmic foci along with other proteins involved in the 5′ to 3′ mRNA decay. These foci are termed PB (processing bodies) or DCP-bodies.

General description The previously assigned protein identifier B1ANC0 has been merged into Q9Y5R5. Full details can be found on the UniProt database.

Immunogen Synthetic peptide directed towards the middle region of human DMRTA1 Biochem/physiol Actions DMRTA1 may be involved in sexual development. Sequence Synthetic peptide located within the following region:

General description Anti-DNA Polymerase &#950: antibody detects endogenous levels of total DNA polymerase &#950: protein. The REV3L (reversionless 3-like) gene is mapped to human chromosome 6q21.

Immunogen Synthetic peptide directed towards the middle region of human DPYSL2 Biochem/physiol Actions DPYSL2 belongs to the DHOase family. It is necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton.

Immunogen Synthetic peptide directed towards the middle region of mouse Elf5 Biochem/physiol Actions Elf5 is a transcriptionally activator that may play a role in regulating the later stages of keratinocytes terminal differentiation. Elf5 binds

General description Emerin is a serine-rich nuclear membrane protein and a member of the nuclear lamina-associated protein family. It mediates membrane anchorage to the cytoskeleton.

Immunogen Synthetic peptide directed towards the N-terminal region of Human EMX2 Biochem/physiol Actions The homeodomain transcription factor EMX2 is critical for central nervous system and urogenital development. EMX1 along with EMX2 is related

Immunogen Synthetic peptide directed towards the C terminal region of human ERGIC3 Biochem/physiol Actions ERGIC3 plays a possible role in transport between endoplasmic reticulum and Golgi. Sequence Synthetic peptide located within the following

General description This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a

Immunogen Synthetic peptide directed towards the middle region of human EVI1 Sequence Synthetic peptide located within the following region: KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT Physical form Purified antibody supplied in 1x PBS