Other Peptides

Immunogen A synthesized peptide derived from human GFP Physical form Buffer: PBS with 0.02% sodium azide,0.

Sequence Synthetic peptide located within the following region: SDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDA Physical form Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.

General description Anti-GLUT3 Antibody detects endogenous levels of total GLUT3 protein. Solute carrier family 2 member 3 (SLC2A3), also known as glucose transporter -3 (GLUT-3), is encoded by the gene mapped to human chromosome 12p13.

General description ARTS1/Adipocyte-derived leucine aminopeptidase (A-LAP) is a member of the M1 family of zinc metallopeptidases. A-LAP is upregulatable by gamma interferon and trims N-terminal lysine, leucine, tyrosine and asparagines residues

General description The protein encoded by this gene is a member of the heat shock protein 70 (HSP70) family. It is localized in the lumen of the endoplasmic reticulum (ER), and is involved in the folding and assembly of proteins in the ER.

Immunogen Synthetic peptide directed towards the N terminal region of human GSDML Biochem/physiol Actions GSDML belongs to the gasdermin family.GSDML may play a role as secretory or metabolic product involved in secretory pathway.

Immunogen Synthetic peptide directed towards the N terminal region of human GTF2F1 Application Anti-GTF2F1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 &#956g/ml. Biochem/physiol Actions GTF2F1 is a

Immunogen Synthetic peptide directed towards the middle region of human GTPBP10 Biochem/physiol Actions Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such

Immunogen Synthetic peptide directed towards the middle region of human HDGFRP3 Sequence Synthetic peptide located within the following region: GSKRKKSYTSKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGDAGNDTRNT Physical form Purified antibody supplied in 1x

General description Laminin subunit b1 (UniProt: P07942: also known as Laminin B1 chain, Laminin-1 subunit beta) is encoded by the LAMB1 gene (Gene ID: 3912) in human. Laminins are the major non-collagenous constituent of basement membranes that

General description Laminin subunit b1 (UniProt: P07942: also known as Laminin B1 chain, Laminin-1 subunit beta) is encoded by the LAMB1 gene (Gene ID: 3912) in human. Laminins are the major non-collagenous constituent of basement membranes that

Anti-Histone H3 (N-terminal) specifically recognizes human histone H3 (~17kDa). Histone H3/ histone cluster 1 H3 family member a (HIST1H3A) is a core member of the histone family.