Viral Peptides

General description The CellASIC &#174: Microfludic single cell isolation chips are microfluidic chips that enable rapid, damage-free isolation of single cells. These devices are less time-consuming and more efficient when compared to limiting

Immunogen Synthetic peptide directed towards the middle region of human ND6 Sequence Synthetic peptide located within the following region: DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT Physical form Purified antibody supplied in 1x PBS

Immunogen Peptide sequence around phosphorylation site of serine 157 (R-V-S(p)-N-A), according to the protein VASP. Features and Benefits Evaluate our antibodies with complete peace of mind.

General description This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions.

Anti-RELA v-rel avian reticuloendotheliosis viral oncogene h

Anti-RELA v-rel avian reticuloendotheliosis viral oncogene h

Anti-RELB v-rel avian reticuloendotheliosis viral oncogene h

Anti-RELB v-rel avian reticuloendotheliosis viral oncogene h

General description IBRDC3 is a cytolysis-associated transmembrane protein expressed in natural killer (NK) cells and T lymphocytes following cytokine stimulation. Immunogen Synthetic peptide directed towards the C-terminal region of Human

General description This gene encodes a member of the R-Ras subfamily of Ras-like small GTPases. The encoded protein associates with the plasma membrane and may function as a signal transducer.

General description The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the

General description WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a